Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: comte-PHAZ

Comamonas testosteroni (Pseudomonas testosteroni), Comamonas sp, poly(3-hydroxybutyrate) depolymerase

Comment
c-term Fibronectin 3 domain excluded. Other strains: Comamonas testosteroni (Pseudomonas testosteroni) (strain KF-1), Comamonas sp.


Relationship
Family|Esterase_phb_PHAZ
Block| X
Position in NCBI Life Tree|Comamonas testosteroni
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Comamonas: N E > Comamonas testosteroni: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AB000508, U16275
3 UniProt : Q46334, O24719, B7X5N5
3 UniProt : O24719, Q46334, B7X5N5
3 Interpro : O24719, Q46334, B7X5N5
3 Pfam : O24719, Q46334, B7X5N5
3 PIRSF : O24719, Q46334, B7X5N5
3 SUPERFAM : O24719, Q46334, B7X5N5
Sequence
Graphical view for this peptide sequence: comte-PHAZ
Colored MSA for Esterase_phb_PHAZ (raw)
MRVQSWRSGVAALALWGGVNLAAGAAVPLGQYNIATDQISVSGLSSGGFM
ANQLGNAYSASFMGVGIFAAGPYMCAGLNNYTACMYNASISSAQLNAMQS
SIDSYSSAASIDAKSRIAAQKIYIFTGTSDYTVGPNLTDALQTQYLNNGV
PQGNIAYVKRSGAAHVLPTDFDSSGNNACSSSASPYISNCGYDGAKAALT
HFYGALNPRNDAPATGNYIEFNQASYTNANPGMASTGWLYVPQSCASGTQ
CRLHVVLHGCQQSTDKIGDKFVRNTGFSRWADTNNIIVLYPQTQVDNNNR
STSKSGSLANPNACWDWIGWYGNNFAQKSGVQMTAIKAMIDRIASGAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRVQSWRSGVAALALWGGVNLAAGAAVPLGQYNIATDQISVSGLSSGGFM
ANQLGNAYSASFMGVGIFAAGPYMCAGLNNYTACMYNASISSAQLNAMQS
SIDSYSSAASIDAKSRIAAQKIYIFTGTSDYTVGPNLTDALQTQYLNNGV
PQGNIAYVKRSGAAHVLPTDFDSSGNNACSSSASPYISNCGYDGAKAALT
HFYGALNPRNDAPATGNYIEFNQASYTNANPGMASTGWLYVPQSCASGTQ
CRLHVVLHGCQQSTDKIGDKFVRNTGFSRWADTNNIIVLYPQTQVDNNNR
STSKSGSLANPNACWDWIGWYGNNFAQKSGVQMTAIKAMIDRIASGAG


References
    Title: Mineralization of individual congeners of linear alkylbenzenesulfonate by defined pairs of heterotrophic bacteria
    Schleheck D, Knepper TP, Fischer K, Cook AM
    Ref: Applied Environmental Microbiology, 70:4053, 2004 : PubMed

            

    Title: Cloning of the gene for poly(3-hydroxybutyric acid) depolymerase of Comamonas testosteroni and functional analysis of its substrate-binding domain
    Shinomiya M, Iwata T, Kasuya K, Doi Y
    Ref: FEMS Microbiology Letters, 154:89, 1997 : PubMed

            

    Title: Characterization of the extracellular poly(3-hydroxybutyrate) depolymerase of Comamonas sp. and of its structural gene
    Jendrossek D, Backhaus M, Andermann M
    Ref: Can J Microbiol, 41 Suppl 1:160, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer