Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cora7-c3piw1

Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1 (Corynebacterium nigricans)) Putative esterase

Relationship
Family|A85-Mycolyl-transferase
Block| X
Position in NCBI Life Tree|Corynebacterium aurimucosum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium aurimucosum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001601
1 UniProt : C3PIW1
1 UniProt : C3PIW1
1 Interpro : C3PIW1
1 Prodom : C3PIW1
1 Pfam : C3PIW1
1 PIRSF : C3PIW1
1 SUPERFAM : C3PIW1
Sequence
Graphical view for this peptide sequence: cora7-c3piw1
Colored MSA for A85-Mycolyl-transferase (raw)
MLSFVSRSRRAAALVAAAMVALGTASASIGSASAQSSTIGEVSSRVTNPQ
PWLGDKAFITAKRHMGGNHWVVDVWSPANHAVISNNVLLPEGDKPRPSFY
LLPGVEGGQAGMNWMTHSDIRHWAVGKNVNVVMPLGGAYSLYTDWNAEDP
ILGVNKWNTYMTAELPPLIDAEFHGTGRDAIGGISSTGGAALDIAGHAPQ
RYKAAASYSGCPVRSGAIGFPTSTAMIAYGGGSSFNAWGLPGSPQWFEHD
PNANPGRLRDVEVFVGSASGTPGPIDGTNSPAQLLGPRAVEMVANQCSEE
FTRNARNAGVRVNRYFSPQGSHTFNLFSHQMKLSWDQTIARTIGA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLSFVSRSRRAAALVAAAMVALGTASASIGSASAQSSTIGEVSSRVTNPQ
PWLGDKAFITAKRHMGGNHWVVDVWSPANHAVISNNVLLPEGDKPRPSFY
LLPGVEGGQAGMNWMTHSDIRHWAVGKNVNVVMPLGGAYSLYTDWNAEDP
ILGVNKWNTYMTAELPPLIDAEFHGTGRDAIGGISSTGGAALDIAGHAPQ
RYKAAASYSGCPVRSGAIGFPTSTAMIAYGGGSSFNAWGLPGSPQWFEHD
PNANPGRLRDVEVFVGSASGTPGPIDGTNSPAQLLGPRAVEMVANQCSEE
FTRNARNAGVRVNRYFSPQGSHTFNLFSHQMKLSWDQTIARTIGA


Reference
    Title: Complete genome sequence and lifestyle of black-pigmented Corynebacterium aurimucosum ATCC 700975 (formerly C. nigricans CN-1) isolated from a vaginal swab of a woman with spontaneous abortion
    Trost E, Gotker S, Schneider J, Schneiker-Bekel S, Szczepanowski R, Tilker A, Viehoever P, Arnold W, Bekel T and Tauch A <6 more author(s)>
    Ref: BMC Genomics, 11:91, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer