Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: coref-CE0103

Corynebacterium efficiens hypothetical protein

Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Corynebacterium efficiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium efficiens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP005214
1 UniProt : Q8FUB7
1 Interpro : Q8FUB7
1 Pfam : Q8FUB7
1 PIRSF : Q8FUB7
1 SUPERFAM : Q8FUB7
Sequence
Graphical view for this peptide sequence: coref-CE0103
Colored MSA for Esterase_phb (raw)
MHKCPASLSWRGMEHPFRTLTLALAAGMTSAALAVAPAASAVAQAQPTAS
AAQSAPTTQVIGTNLLHASFTQDGMHREYLVKLPDNRDPARTYPIVLAFG
GKGDSATSFRSYAGLEQATAGGAIIVYAQGVDNAWAGAPYAATTMAQDVA
YVRTAVDDVVAHHGGDRGRVYAVGMSNGGGMATALGCHAPELVDATASVA
GAYYDPTVTGCNPRGGVPTLVIHGTNDGLMNYWGGTRHGAHYRGAYAVFE
SFAARNHCTVPVVHQVHEHPNSTTFRPAFCATPTEFVRIDDGGHEWSYTP
SVADISWGFLQRQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHKCPASLSWRGMEHPFRTLTLALAAGMTSAALAVAPAASAVAQAQPTAS
AAQSAPTTQVIGTNLLHASFTQDGMHREYLVKLPDNRDPARTYPIVLAFG
GKGDSATSFRSYAGLEQATAGGAIIVYAQGVDNAWAGAPYAATTMAQDVA
YVRTAVDDVVAHHGGDRGRVYAVGMSNGGGMATALGCHAPELVDATASVA
GAYYDPTVTGCNPRGGVPTLVIHGTNDGLMNYWGGTRHGAHYRGAYAVFE
SFAARNHCTVPVVHQVHEHPNSTTFRPAFCATPTEFVRIDDGGHEWSYTP
SVADISWGFLQRQ


Reference
    Title: Comparative complete genome sequence analysis of the amino acid replacements responsible for the thermostability of Corynebacterium efficiens
    Nishio Y, Nakamura Y, Kawarabayasi Y, Usuda Y, Kimura E, Sugimoto S, Matsui K, Yamagishi A, Kikuchi H and Gojobori T <1 more author(s)>
    Ref: Genome Res, 13:1572, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer