Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cutac-e6dae5

Cutibacterium acnes (Propionibacterium acnes) HL110PA4 Lysophospholipase

Comment
Other strains: Cutibacterium acnes (Propionibacterium acnes) (HL110PA4; J139; HL201PA1)


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Cutibacterium acnes HL110PA4
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Propionibacteriaceae: N E > Cutibacterium: N E > Cutibacterium acnes: N E > Propionibacterium acnes HL110PA4: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 6KHK, 6KHL, 6KHM
No kinetic





1 substrate:
2,3-Dimercapto-1-propanol-tributyrate
2 inhibitors: PMSF, Phenylacetone
>3 Genbank links 3 more: GAE78567, EFT62207, WP_002514103
>3 UniProt links 1 more: W4UCL8, E6DAE5, D1YBL7
3 Structure : 6KHK, 6KHL, 6KHM
3 UniProt : W4UCL8, E6DAE5, A0A085B570
3 Interpro : W4UCL8, E6DAE5, A0A085B570
3 Prodom : W4UCL8, E6DAE5, A0A085B570
3 Pfam : W4UCL8, E6DAE5, A0A085B570
3 PIRSF : W4UCL8, E6DAE5, A0A085B570
3 SUPERFAM : W4UCL8, E6DAE5, A0A085B570
Sequence
Graphical view for this peptide sequence: cutac-e6dae5
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MALQEIEFTSHNGRDAIQAWAYEPVGTPTAVVQIIHGLGEHSRRYLHMIS
ALLDAGFVVIADDHAGHGRTAMQSGVWADAGDNAAEVVISDELTLQQQLA
GQFDDLPWVVFGHSWGSMIARAMATRPGTRLDGLALCGIVAQPRGFETTL
DHKTLAKAMATAPTDPAPEALVAQMFDGFADRLSEDDGPTGWVARSKEVV
ADHGKDKFNNFGAPMSTRFLQGLADIYAMANGDSFYATMPNIPIVLFAGS
EDPAGDFGTGVKAVAERLRRDGHNVELHLYDGLRHEVHNEPESRADVESS
LVTFVDRVANRRIKRSR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MALQEIEFTSHNGRDAIQAWAYEPVGTPTAVVQIIHGLGEHSRRYLHMIS
ALLDAGFVVIADDHAGHGRTAMQSGVWADAGDNAAEVVISDELTLQQQLA
GQFDDLPWVVFGHSWGSMIARAMATRPGTRLDGLALCGIVAQPRGFETTL
DHKTLAKAMATAPTDPAPEALVAQMFDGFADRLSEDDGPTGWVARSKEVV
ADHGKDKFNNFGAPMSTRFLQGLADIYAMANGDSFYATMPNIPIVLFAGS
EDPAGDFGTGVKAVAERLRRDGHNVELHLYDGLRHEVHNEPESRADVESS
LVTFVDRVANRRIKRSR


Reference
    Title: The grease trap: Uncovering the mechanism of the hydrophobic lid in Cutibacterium acnes lipase
    Kim HJ, Lee BJ, Kwon AR
    Ref: J Lipid Res, :, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer