Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cyaa5-b1x1h4

Cyanothece (strain ATCC 51142) Putative uncharacterized protein

Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|Cyanothece
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Oscillatoriophycideae: N E > Oscillatoriales: N E > Cyanothecaceae: N E > Cyanothece: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000806
1 UniProt : B1X1H4
1 UniProt : B1X1H4
1 Interpro : B1X1H4
1 Pfam : B1X1H4
1 PIRSF : B1X1H4
1 SUPERFAM : B1X1H4
Sequence
Graphical view for this peptide sequence: cyaa5-b1x1h4
Colored MSA for BD-FAE (raw)
MFKFKPQLLLILVVPFLIMILPLLVKLTDRVRRVTTAPQNYQKHLNITYL
EVNNISLKLDIYAPKNKNEPVSTLIYFHGGGWISGTKDATLSSILPYIKK
GWGVVTVQYRLGNVSLAPAAVKDSLCAVKWVINNGDEYGFDVNKIVLSGE
SAGGHLALITGMLPASSDLDHQCPDNKKIKVAAIVNWYGIADVVDVLQGE
NQQDYAVEWLGNQSDRLNIAQKISPINYVRDDLPPILTIHGDADTLVPYS
HAVQLHQALEKAQVPNELMTITDGGHGGFGNKEMTAIYETIDHFLGSHLH
QK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFKFKPQLLLILVVPFLIMILPLLVKLTDRVRRVTTAPQNYQKHLNITYL
EVNNISLKLDIYAPKNKNEPVSTLIYFHGGGWISGTKDATLSSILPYIKK
GWGVVTVQYRLGNVSLAPAAVKDSLCAVKWVINNGDEYGFDVNKIVLSGE
SAGGHLALITGMLPASSDLDHQCPDNKKIKVAAIVNWYGIADVVDVLQGE
NQQDYAVEWLGNQSDRLNIAQKISPINYVRDDLPPILTIHGDADTLVPYS
HAVQLHQALEKAQVPNELMTITDGGHGGFGNKEMTAIYETIDHFLGSHLH
QK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer