Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: dyafd-c6vye5

Phospholipase/Carboxylesterase from Dyadobacter fermentans DSM 18053

Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Dyadobacter fermentans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Cytophagia: N E > Cytophagales: N E > Cytophagaceae: N E > Dyadobacter: N E > Dyadobacter fermentans: N E


Molecular evidence
Database
No mutation
1 structure:
4H0C: Crystal structure of phospholipase/Carboxylesterase from Dyadobacter fermentans DSM 18053
No kinetic





No Substrate
No inhibitor
1 UniProt : C6VYE5
1 Structure : 4H0C
1 UniProt : C6VYE5
1 Interpro : C6VYE5
1 Prodom : C6VYE5
1 Pfam : C6VYE5
1 PIRSF : C6VYE5
1 SUPERFAM : C6VYE5
Sequence
Graphical view for this peptide sequence: dyafd-c6vye5
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MYTHSKQIITSGVPVQRAKKAVVMLHGRGGTAADIISLQKVLKLDEMAIY
APQATNNSWYPYSFMAPVQQNQPALDSALALVGEVVAEIEAQGIPAEQIY
FAGFSQGACLTLEYTTRNARKYGGIIAFTGGLIGQELAIGNYKGDFKQTP
VFISTGNPDPHVPVSRVQESVTILEDMNAAVSQVVYPGRPHTISGDEIQL
VNNTILK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYTHSKQIITSGVPVQRAKKAVVMLHGRGGTAADIISLQKVLKLDEMAIY
APQATNNSWYPYSFMAPVQQNQPALDSALALVGEVVAEIEAQGIPAEQIY
FAGFSQGACLTLEYTTRNARKYGGIIAFTGGLIGQELAIGNYKGDFKQTP
VFISTGNPDPHVPVSRVQESVTILEDMNAAVSQVVYPGRPHTISGDEIQL
VNNTILK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer