Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: emeni-AnEstB

Emericella nidulans (Aspergillus nidulans) siderophore-degrading esterase AnEstB

Comment
Other strains: Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)


Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Emericella nidulans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus nidulans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6GUN: Emericella nidulans (Aspergillus nidulans) siderophore-degrading esterase AnEstB
No kinetic





1 substrate:
Triacetylfusigen
No inhibitor
1 Genbank : BN001305.1
1 UniProt : A0A3F2YM31
1 Structure : 6GUN
1 UniProt : A0A3F2YM31
1 Interpro : A0A3F2YM31
1 Pfam : A0A3F2YM31
1 PIRSF : A0A3F2YM31
1 SUPERFAM : A0A3F2YM31
Sequence
Graphical view for this peptide sequence: emeni-AnEstB
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
GSTQIDKPAVVSLPSSEQFYLNNSRGERYLIQVSWPLHWKDHKPDTDRND
VPLIYIVDGNALFLTATEALWRRSADSHYCGGGIVVAIGYPLEGTGKVYH
RVRRGFDLTVPTPDSPVEGHGGADILLDFIAETVRPAVRERFPDVSVSRE
ALYGHSYGGLFALHALFTRPSMFDAYIASSPSIWWNGRCILNEAKAFTRK
IKENGAYTNGEKKLPSLMMYLGGLEQDPRRWNDEPDESWEGRKRDAEAFN
MKVNLLELMGLIRGCTRLHAVSFSEYAGEDHGTVMACSLGRGFSTFMEDW
PVPREESV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GSTQIDKPAVVSLPSSEQFYLNNSRGERYLIQVSWPLHWKDHKPDTDRND
VPLIYIVDGNALFLTATEALWRRSADSHYCGGGIVVAIGYPLEGTGKVYH
RVRRGFDLTVPTPDSPVEGHGGADILLDFIAETVRPAVRERFPDVSVSRE
ALYGHSYGGLFALHALFTRPSMFDAYIASSPSIWWNGRCILNEAKAFTRK
IKENGAYTNGEKKLPSLMMYLGGLEQDPRRWNDEPDESWEGRKRDAEAFN
MKVNLLELMGLIRGCTRLHAVSFSEYAGEDHGTVMACSLGRGFSTFMEDW
PVPREESV


Reference
    Title: Iron Scavenging in Aspergillus Species: Structural and Biochemical Insights into Fungal Siderophore Esterases
    Ecker F, Haas H, Groll M, Huber EM
    Ref: Angew Chem Int Ed Engl, 57:14624, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer