(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Alteromonadales: NE > Ferrimonadaceae: NE > Ferrimonas: NE > Ferrimonas balearica: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MFRCLFLLLLIALPCHAIERKAFPAEAPGSKGTVIVLADAGAVVDSGHWQ RTLLRTLPRHGWRALSVAQYDGLSSLPEALQSEPEPHYWVVSGATAGEAV NAMATQQLPLPAGLVVLGPFRQTPAENDALPAQLAELGIAVLDMSGPGDH PLAQATTEARQQANRRTANPHYRAMDWALDWDQSADTLAQRIRGWLKQQK TSPQ
Ferrimonas balearica Rossello-Mora et al. 1996 is the type species of the genus Ferrimonas, which belongs to the family Ferrimonadaceae within the Gammaproteobacteria. The species is a Gram-negative, motile, facultatively anaerobic, non spore-forming bacterium, which is of special interest because it is a chemoorganotroph and has a strictly respiratory metabolism with oxygen, nitrate, Fe(III)-oxyhydroxide, Fe(III)-citrate, MnO(2), selenate, selenite and thiosulfate as electron acceptors. This is the first completed genome sequence of a member of the genus Ferrimonas and also the first sequence from a member of the family Ferrimonadaceae. The 4,279,159 bp long genome with its 3,803 protein-coding and 144 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.
