Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: funhe-a0a146ncz7

Fundulus heteroclitus (Killifish) (Mummichog). Carboxylic ester hydrolase

Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Fundulus heteroclitus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Ovalentaria: N E > Atherinomorphae: N E > Cyprinodontiformes: N E > Cyprinodontoidei: N E > Fundulidae: N E > Fundulus: N E > Fundulus heteroclitus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GCES01157125
Sequence
Graphical view for this peptide sequence: funhe-a0a146ncz7
Colored MSA for Carb_B_Chordata (raw)
MKFRVCFTLVASVWFLSAAADPQAPEVQIRLGRLRGQYVSVKGKETGVHA
FLGVPFAKPPLGPSLRLAAPQPPEGWQGLRDATKQPNMCVQDVEIMKDLM
KKLGGMNAELPDASEDCLYLNIYTPANRAPDAKLPVMVWIHGGGFVLGSA
SMCDGSALAAYQDVVVVLIQYRLGLLGFLSTGDEHVPGNFGLLDQIQALR
WVKEHIDNFGGNPDLVTIFGESAGGVSVSLLLLSPLSDGLFHRAIAESGT
AAMDVLVSDNPVPAMQAAANASGCSLESTEKIAKCMLNLDIDTILALVKN
PNLRYTINVDGHFLTKPVPELFQTHQLLTIPFMTGINNHEGGFLLANHFA
PPNWTEGMDQESVVNSMFIFYPLPEAAATRDLIAKEYIGSGEDRIRNRDG
FTELLGDFFFTFPAIKAANAHRDAGADVYLYEYHYAPKFLQKIRPSFVKC
DHADELFSVLGFCFTTTHVKLVDACHEEEYHYAPKFLQKKRPSFVKSDHA
DELFSVLGSCFTTTHVKLVEACPEEEEEFSRIMMSYWGNFARTGSPNGDG
LVDWPKYGAEERYMSLDVKEQTPRQSLKKDRFIFVTQTLPQKIRDHEENV
GRSEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFRVCFTLVASVWFLSAAADPQAPEVQIRLGRLRGQYVSVKGKETGVHA
FLGVPFAKPPLGPSLRLAAPQPPEGWQGLRDATKQPNMCVQDVEIMKDLM
KKLGGMNAELPDASEDCLYLNIYTPANRAPDAKLPVMVWIHGGGFVLGSA
SMCDGSALAAYQDVVVVLIQYRLGLLGFLSTGDEHVPGNFGLLDQIQALR
WVKEHIDNFGGNPDLVTIFGESAGGVSVSLLLLSPLSDGLFHRAIAESGT
AAMDVLVSDNPVPAMQAAANASGCSLESTEKIAKCMLNLDIDTILALVKN
PNLRYTINVDGHFLTKPVPELFQTHQLLTIPFMTGINNHEGGFLLANHFA
PPNWTEGMDQESVVNSMFIFYPLPEAAATRDLIAKEYIGSGEDRIRNRDG
FTELLGDFFFTFPAIKAANAHRDAGADVYLYEYHYAPKFLQKIRPSFVKC
DHADELFSVLGFCFTTTHVKLVDACHEEEYHYAPKFLQKKRPSFVKSDHA
DELFSVLGSCFTTTHVKLVEACPEEEEEFSRIMMSYWGNFARTGSPNGDG
LVDWPKYGAEERYMSLDVKEQTPRQSLKKDRFIFVTQTLPQKIRDHEENV
GRSEL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer