Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: funhe-a0a146nnz9

Fundulus heteroclitus (Killifish) (Mummichog); Iconisemion striatum; Nothobranchius furzeri (Turquoise killifish); N kadleci; N. korthausae; N. kuhntae (Beira killifish); N. pienaari; N.rachovii (bluefin notho); Scleropages formosus (Asian bonytongue). Abhydrolase domain-containing protein 16A

Comment
Other strains: Fundulus heteroclitus (Killifish) (Mummichog); Iconisemion striatum; Nothobranchius furzeri (Turquoise killifish); Nothobranchius kadleci; Nothobranchius korthausae; Nothobranchius kuhntae (Beira killifish); Nothobranchius pienaari; Nothobranchius rachovii (bluefin notho); Scleropages formosus (Asian bonytongue)


Relationship
Family|ABHD16
Block| X
Position in NCBI Life Tree|Fundulus heteroclitus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Ovalentaria: N E > Atherinomorphae: N E > Cyprinodontiformes: N E > Cyprinodontoidei: N E > Fundulidae: N E > Fundulus: N E > Fundulus heteroclitus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 18 more: GCES01153155, XP_012725770.1, GCES01146855
>3 UniProt links 7 more: A0A146NNZ9, A0A1A7YNE8, A0A1A8AVL0
>3 UniProt links 7 more: A0A146NNZ9, A0A1A7YNE8, A0A1A8AVL0
>3 Interpro links 7 more: A0A146NNZ9, A0A1A7YNE8, A0A1A8AVL0
>3 Pfam links 7 more: A0A146NNZ9, A0A1A7YNE8, A0A1A8AVL0
>3 PIRSF links 7 more: A0A146NNZ9, A0A1A7YNE8, A0A1A8AVL0
>3 SUPERFAM links 7 more: A0A146NNZ9, A0A1A7YNE8, A0A1A8AVL0
Sequence
Graphical view for this peptide sequence: funhe-a0a146nnz9
Colored MSA for ABHD16 (raw)
MAAWMLYRCVFGPRLQRIHRPPQEQPRPEGRLVRRGWNYQPRSLEKHTDS
ILGWASAIWSLSYYSSPLLLCYLYRKGYICSSKLVPVSQYLGTVLVCLLG
VACLRGWGRWKNSDYVQFLSVLEETKKNHTPENKKKLRCYDFDFSHWPSD
FSWAEVSSPKQSKGGVSLLKPEPRLRGTADGFLNSVRTLPCHVIGFLITH
TFGRRMLYPGSVGLLQKAMRSVLQQGQAKLIEEYDGQRNKLVACDGNEID
TMFVDRRKEGGPNSQTLVICCEGNAGFYEVGCMNTPLEGGYSVLGWNHPG
FGGSTGVPFPQNEANAMDVVIQFAVHKLGFQLGDIVIYAWSIGGFTASWA
VMSYPEIQSVVLDASFDDLLPLALKVMPESWRPLVQHTVRQYMNLNNAEQ
LLKYQGPVLLVRRTRDEIITTTGPEDIMSNRGNDLLLKLLQFRYPKIMTD
DGIRVVRQWLGAPGPFEEASVYSAYEVDDDWCTSVLQSYQADRDVSFPWS
VGEDMALEGRRQLALFLARKYMRNFESTHCTPLPAAEFHSPWRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAWMLYRCVFGPRLQRIHRPPQEQPRPEGRLVRRGWNYQPRSLEKHTDS
ILGWASAIWSLSYYSSPLLLCYLYRKGYICSSKLVPVSQYLGTVLVCLLG
VACLRGWGRWKNSDYVQFLSVLEETKKNHTPENKKKLRCYDFDFSHWPSD
FSWAEVSSPKQSKGGVSLLKPEPRLRGTADGFLNSVRTLPCHVIGFLITH
TFGRRMLYPGSVGLLQKAMRSVLQQGQAKLIEEYDGQRNKLVACDGNEID
TMFVDRRKEGGPNSQTLVICCEGNAGFYEVGCMNTPLEGGYSVLGWNHPG
FGGSTGVPFPQNEANAMDVVIQFAVHKLGFQLGDIVIYAWSIGGFTASWA
VMSYPEIQSVVLDASFDDLLPLALKVMPESWRPLVQHTVRQYMNLNNAEQ
LLKYQGPVLLVRRTRDEIITTTGPEDIMSNRGNDLLLKLLQFRYPKIMTD
DGIRVVRQWLGAPGPFEEASVYSAYEVDDDWCTSVLQSYQADRDVSFPWS
VGEDMALEGRRQLALFLARKYMRNFESTHCTPLPAAEFHSPWRL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer