Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: geocn-d0f1s1

Geotrichum candidum (Oospora lactis) (Dipodascus geotrichum) Lipase

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Geotrichum candidum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Dipodascaceae: N E > Galactomyces: N E > Galactomyces candidum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GQ985500
1 UniProt : D0F1S1
1 UniProt : D0F1S1
1 Interpro : D0F1S1
1 Pfam : D0F1S1
1 PIRSF : D0F1S1
1 SUPERFAM : D0F1S1
Sequence
Graphical view for this peptide sequence: geocn-d0f1s1
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MVSKSFFLAAAVNVVGALGQAPTAVVNGNEVITGVLEGKVDTFKGIPFAD
PPLADLRFKHPQSFSGSYQGFQAKDFSSACMQLDPYNALTLLDKALNLGN
IIPDDIRGPLYDMAKGTVSMSEDCLYLNVFRPAGTKPDAKLPVMVWIYGG
AFIFGSSATYPGNGYVTESVAMGQPVVFVSINYRTGPFGFLGGDAITAEG
NTNSGLHDQRKALEWVSDNIANFGGDPDKVMIFGESAGAMSVAHQLIAYG
GDNTYNGKALFHSAILQSGGPLPYYNSSSVGPESAYTRFAQYAGCDTSTS
DNNILQCLRSKPSSVLHDAQNSYDLKDLFGLLPQFLGFGPRPDGDIIPDA
AYELYRSGRYAKVPYITGNQEDEGTILAPVAINATTTAHVKKWLKYIFSE
ASDSSLDRVLSLYPQTLSEGSPFRTGILNALTPQFKRVSAILSDLLFQSP
RRVMLSSTKDVDRWTYLSTHLHNLVPFLGTFHGNELIFQFNINTGPADSY
LRYFISFANHHDPNVGTNLLNWNKYTDEGKEMLEIHMTDNSMRTDDFRID
GISNFESDVNLYG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVSKSFFLAAAVNVVGALGQAPTAVVNGNEVITGVLEGKVDTFKGIPFAD
PPLADLRFKHPQSFSGSYQGFQAKDFSSACMQLDPYNALTLLDKALNLGN
IIPDDIRGPLYDMAKGTVSMSEDCLYLNVFRPAGTKPDAKLPVMVWIYGG
AFIFGSSATYPGNGYVTESVAMGQPVVFVSINYRTGPFGFLGGDAITAEG
NTNSGLHDQRKALEWVSDNIANFGGDPDKVMIFGESAGAMSVAHQLIAYG
GDNTYNGKALFHSAILQSGGPLPYYNSSSVGPESAYTRFAQYAGCDTSTS
DNNILQCLRSKPSSVLHDAQNSYDLKDLFGLLPQFLGFGPRPDGDIIPDA
AYELYRSGRYAKVPYITGNQEDEGTILAPVAINATTTAHVKKWLKYIFSE
ASDSSLDRVLSLYPQTLSEGSPFRTGILNALTPQFKRVSAILSDLLFQSP
RRVMLSSTKDVDRWTYLSTHLHNLVPFLGTFHGNELIFQFNINTGPADSY
LRYFISFANHHDPNVGTNLLNWNKYTDEGKEMLEIHMTDNSMRTDDFRID
GISNFESDVNLYG



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer