Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibm7-fdb39

Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides). Fusarium detoxification of benzoxazolinone cluster 2 protein FVEG_12639

Comment
Esterase; part of the Fusarium detoxification of benzoxazolinone cluster 2 (FDB2) involved in the degradation of benzoxazolinones produced by the host plant


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Gibberella moniliformis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium fujikuroi species complex: N E > Fusarium verticillioides: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : DS022261, XP_018760612
1 UniProt : W7MTJ1
1 UniProt : W7MTJ1
1 Interpro : W7MTJ1
1 Pfam : W7MTJ1
1 PIRSF : W7MTJ1
1 SUPERFAM : W7MTJ1
Sequence
Graphical view for this peptide sequence: gibm7-fdb39
Colored MSA for Hormone-sensitive_lipase_like (raw)
MVSLDPINAKFAAAIDGLPAPHQLGGPGKAFENLEELQRHEPANDIATQV
IKVEGKYGPTSVTLFRSKALVDKPLPMIFYTHGGGWVMGSAKSFAVLVED
LARRTGAAVIFPDYTLAPHQTFPFPFEQSYEVLEYMIRHGKEYNLLVKTI
ALAGDSVGGHMAIAMMQMSLQRQLPATISQIVLWAPVTVTHKKYPSYTTF
KDGPFLPEATMDWMIDTFIPSKSDRETALASPLTHLPDDVLSKFPPTIIF
LSTVDPLVDEGVAFGQRLQGLGVDASVIKAEGQMHAFCLVTALRDGPTAQ
AVLELAALRLRKIFPDSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVSLDPINAKFAAAIDGLPAPHQLGGPGKAFENLEELQRHEPANDIATQV
IKVEGKYGPTSVTLFRSKALVDKPLPMIFYTHGGGWVMGSAKSFAVLVED
LARRTGAAVIFPDYTLAPHQTFPFPFEQSYEVLEYMIRHGKEYNLLVKTI
ALAGDSVGGHMAIAMMQMSLQRQLPATISQIVLWAPVTVTHKKYPSYTTF
KDGPFLPEATMDWMIDTFIPSKSDRETALASPLTHLPDDVLSKFPPTIIF
LSTVDPLVDEGVAFGQRLQGLGVDASVIKAEGQMHAFCLVTALRDGPTAQ
AVLELAALRLRKIFPDSA


References
1 more
    Title: FDB2 encodes a member of the arylamine N-acetyltransferase family and is necessary for biotransformation of benzoxazolinones by Fusarium verticillioides
    Glenn AE, Bacon CW
    Ref: J Appl Microbiol, 107:657, 2009 : PubMed

            

    Title: Identification of intermediate and branch metabolites resulting from biotransformation of 2-benzoxazolinone by Fusarium verticillioides
    Glenn AE, Meredith FI, Morrison WH, 3rd, Bacon CW
    Ref: Applied Environmental Microbiology, 69:3165, 2003 : PubMed

            

    Title: Fdb1 and Fdb2, Fusarium verticillioides loci necessary for detoxification of preformed antimicrobials from corn
    Glenn AE, Gold SE, Bacon CW
    Ref: Mol Plant Microbe Interact, 15:91, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer