Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibze-q6wer3

Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum) extracellular lipase (EC 3.1.1.3)

Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Gibberella zeae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium sambucinum species complex: N E > Fusarium graminearum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3NGM: Crystal structure of lipase from Gibberella zeae
No kinetic





No Substrate
No inhibitor
2 Genbank : AY292529, AACM01000237
1 UniProt : Q6WER3
1 Structure : 3NGM
1 UniProt : Q6WER3
1 Interpro : Q6WER3
1 Prodom : Q6WER3
1 Pfam : Q6WER3
1 PIRSF : Q6WER3
1 SUPERFAM : Q6WER3
Sequence
Graphical view for this peptide sequence: gibze-q6wer3
Colored MSA for Lipase_3 (raw)
MRLLSLLSVVTLAVASPLSVEEYAKALDERAVSVSTTDFGNFKFYIQHGA
AAYCNSEAPAGAKVTCSGNGCPTVQSNGATIVASFTGSKTGIGGYVATDP
TRKEIVVSFRGSINIRNWLTNLDFDQDDCSLTSGCGVHSGFQNAWNEISA
AATAAVAKARKANPSFKVVSVGHSLGGAVATLAGANLRVGGTPLDIYTYG
SPRVGNTQLAAFVSNQAGGEFRVTNAKDPVPRLPPLIFGYRHTSPEYWLS
GSGGDKIDYTINDVKVCEGAANLQCNGGTLGLDIDAHLHYFQATDACSAG
GISWRRYRSAKRESISERATMTDAELEKKLNSYVEMDKEYIKTHARPLII
V
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRLLSLLSVVTLAVASPLSVEEYAKALDERAVSVSTTDFGNFKFYIQHGA
AAYCNSEAPAGAKVTCSGNGCPTVQSNGATIVASFTGSKTGIGGYVATDP
TRKEIVVSFRGSINIRNWLTNLDFDQDDCSLTSGCGVHSGFQNAWNEISA
AATAAVAKARKANPSFKVVSVGHSLGGAVATLAGANLRVGGTPLDIYTYG
SPRVGNTQLAAFVSNQAGGEFRVTNAKDPVPRLPPLIFGYRHTSPEYWLS
GSGGDKIDYTINDVKVCEGAANLQCNGGTLGLDIDAHLHYFQATDACSAG
GISWRRYRSAKRESISERATMTDAELEKKLNSYVEMDKEYIKTHARPLII
V


References
2 more
    Title: Exploring the influence of phospholipid monolayer conformation and environmental conditions on the interfacial binding of Gibberella Zeae lipase
    Wang F, Chen W, Abousalham A, Yang B, Wang Y
    Ref: Int J Biol Macromol, 132:1051, 2019 : PubMed

            

    Title: Crystallization and preliminary crystallographic analysis of Gibberella zeae extracellular lipase
    Sun Y, Li M, Zhang Y, Liu L, Liu Y, Liu Z, Li X, Lou Z
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 64:813, 2008 : PubMed

            

    Title: A secreted lipase of Fusarium graminearum is a virulence factor required for infection of cereals
    Voigt CA, Schafer W, Salomon S
    Ref: Plant J, 42:364, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer