Gene_locus Report for: helan-q2xp02Helianthus annuus (Common sunflower) sf21e protein (fragment) Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > campanulids: N E > Asterales: N E > Asteraceae: N E > Asteroideae: N E > Heliantheae alliance: N E > Heliantheae: N E > Helianthus: N E > Helianthus annuus: N E
ABHD13-BEM46 : helan-a0a251ts58Helianthus annuus (Common sunflower). Putative alpha/beta-Hydrolases superfamily protein, helan-a0a251vmq8Helianthus annuus (Common sunflower). Putative alpha/beta hydrolase domain-containing protein 13. Bodyguard : helan-a0a251v9m3Helianthus annuus (Common sunflower) Putative alpha/beta-Hydrolases superfamily protein, helan-a0a251uc64Helianthus annuus (Common sunflower) Putative alpha/beta-Hydrolases superfamily protein, helan-a0a251sun4Helianthus annuus (Common sunflower) Putative alpha/Beta hydrolase fold protein. Glutamyl_Peptidase_S9 : helan-a0a251uh88Helianthus annuus (Common sunflower). Putative WD40/YVTN repeat-like-containing domain, Alpha/Beta hydrolase fold protein, helan-a0a251ux90Helianthus annuus (Common sunflower). Putative prolyl oligopeptidase family protein. Ndr_family : helan-q2xp03Helianthus annuus (Common sunflower) sf21d2 splice variant sf21d1 splice variant protein (fragment), helan-q6pwu0Helianthus annuus (Common sunflower) sf21c1 sf21c2 sf21c3 protein, helan-sf21Helianthus annuus (Common sunflower) pollen specific protein sf21, helan-SF21.xHelianthus annuus (Common sunflower) sf21 protein. Plant_carboxylesterase : helan-a0a251tv75Helianthus annuus (Common sunflower). Putative alpha/Beta hydrolase fold protein, helan-a0a251s253Helianthus annuus (Common sunflower). Putative alpha/Beta hydrolase fold protein, helan-a0a251rur6Helianthus annuus (Common sunflower). Putative alpha/beta-Hydrolases superfamily protein, helan-a0a251ve88Helianthus annuus (Common sunflower). Putative alpha/beta-Hydrolases superfamily protein, helan-a0a251rzb7Helianthus annuus (Common sunflower). Putative lipase, GDXG, putative histidine active site, Alpha/Beta hydrolase fold protein. Plant_lipase_EDS1-like : helan-a0a251vi64Helianthus annuus (Common sunflower). Uncharacterized protein. Triacylglycerol-lipase-OBL1-like : helan-a0a251sb83Helianthus annuus (Common sunflower). Putative alpha/Beta hydrolase fold protein, helan-a0a251txv8Helianthus annuus (Common sunflower). Putative triacylglycerol lipase-like 1, helan-a0a251u1d0Helianthus annuus (Common sunflower). Putative alpha/beta-Hydrolases superfamily protein, helan-a0a251uwi4Helianthus annuus (Common sunflower). Putative alpha/beta-Hydrolases superfamily protein, helan-a0a251uwk5Helianthus annuus (Common sunflower). Putative alpha/beta-Hydrolases superfamily protein, helan-a0a251uxe9Helianthus annuus (Common sunflower). Putative alpha/Beta hydrolase fold protein. UCP031088 : helan-a0a251rty5Helianthus annuus (Common sunflower). Uncharacterized protein, helan-a0a251rwi0Helianthus annuus (Common sunflower). Uncharacterized protein, helan-a0a251s4p0Helianthus annuus (Common sunflower). Putative alpha/beta hydrolase
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: helan-q2xp02
Colored MSA for Ndr_family (raw)
FCPEAASLLLHNFCIYHISPPGHELGAAAICSDDPILSVDDLCDQILEVL
NYFRLGSVMCMGAMAGAYILTLFAIKYRDRVTGLILVSPLYKAPSWTEWL
YNKFMSNLLYYYGMCGLLKECLLQRYFSKEVRGNPEIPESDIVQCCRKLL
DERQSVNVWRYLQAIDKRPDITEGLKKLKCRTLIFVGDSSPFHSEALHMT
GKLDRRYSALVEVQVCGSLVTEEQPRAMLIPMEYFLMGYGLYRPSPITGS
PRSPLSPSCIAPKLLSPESMGLKLKPIKTRGSPPDSSTLMW
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
FCPEAASLLLHNFCIYHISPPGHELGAAAICSDDPILSVDDLCDQILEVL
NYFRLGSVMCMGAMAGAYILTLFAIKYRDRVTGLILVSPLYKAPSWTEWL
YNKFMSNLLYYYGMCGLLKECLLQRYFSKEVRGNPEIPESDIVQCCRKLL
DERQSVNVWRYLQAIDKRPDITEGLKKLKCRTLIFVGDSSPFHSEALHMT
GKLDRRYSALVEVQVCGSLVTEEQPRAMLIPMEYFLMGYGLYRPSPITGS
PRSPLSPSCIAPKLLSPESMGLKLKPIKTRGSPPDSSTLMW
|
|
|
|
