Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: hydvu-ACHE

Hydra vulgaris (Hydra) (Hydra attenuata) Hydra magnipapillata Acetylcholinesterase

Comment
cont2.61778 Hydra genome browser Hma2.213104 Contig35977:56713..54802


Relationship
Family|Cholinesterase-like
Block| C
Position in NCBI Life Tree|Hydra vulgaris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Cnidaria: N E > Hydrozoa: N E > Hydroidolina: N E > Anthoathecata: N E > Aplanulata: N E > Hydridae: N E > Hydra: N E > Hydra vulgaris: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : BAI66654, AB513182, HAAD01005925
2 UniProt : D2KX94, T2MJR3
2 UniProt : D2KX94, T2MJR3
2 Interpro : D2KX94, T2MJR3
2 Prodom : D2KX94, T2MJR3
2 Pfam : D2KX94, T2MJR3
2 PIRSF : D2KX94, T2MJR3
2 SUPERFAM : D2KX94, T2MJR3
Sequence
Graphical view for this peptide sequence: hydvu-ACHE
Colored MSA for Cholinesterase-like (raw)
MSDEKQSIIKEHITKYSKRYDQVSWRSADTDFETASSADEQAKKERSPVI
AKLAHFCIRRNRKITALVVVVLIFLAIMGGLIYLYYSKQNQSFRSSPVVL
IDCGPVTGTIESVKVNNKMFDSFVFKGIPYALPPVKNLRWKAPVALSSNC
WKGTFEATKFGNICVQNTSGVIEGSENCLYLNVWSPRLETDALLPVFVWI
HGGYLMNGFGHQSGYSPDSEFVTSMNVVAVSMNYRLNAFGFLTLKELWVE
NESYGNFGLLDQILVLKWVKKNIQNFGGDPNSVTIVGQSSGGTSIFGLLA
SLPAEGLFQRAITMSASPKFEKSYISAANENQVFIKKSKCKDISVKLKEC
LYNLTSEEVIRAIPNDVYPYWLMEDLLDFPKKDLFDGALIVMEPMSVSEY
PQNIKNINFTTSDKVSVLIGSTAQEIGILPGAIFTGVYQWISLKEYLDKR
LLNFSLSYSKIFDLYKNINNINDSAQYAYETISSDVRINCPSNKLAKDIL
LSNKYDVFRYIVTNYPNKPVSLNGFPPSKYAVHFWDSTALFNFKAVNNYS
LSETDKLFAKTLQENIKHFMIYGHMLRSDWSEGKTGVFNTQGLLETLESD
YHSMICSFWNDPKNDFISYAWIN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSDEKQSIIKEHITKYSKRYDQVSWRSADTDFETASSADEQAKKERSPVI
AKLAHFCIRRNRKITALVVVVLIFLAIMGGLIYLYYSKQNQSFRSSPVVL
IDCGPVTGTIESVKVNNKMFDSFVFKGIPYALPPVKNLRWKAPVALSSNC
WKGTFEATKFGNICVQNTSGVIEGSENCLYLNVWSPRLETDALLPVFVWI
HGGYLMNGFGHQSGYSPDSEFVTSMNVVAVSMNYRLNAFGFLTLKELWVE
NESYGNFGLLDQILVLKWVKKNIQNFGGDPNSVTIVGQSSGGTSIFGLLA
SLPAEGLFQRAITMSASPKFEKSYISAANENQVFIKKSKCKDISVKLKEC
LYNLTSEEVIRAIPNDVYPYWLMEDLLDFPKKDLFDGALIVMEPMSVSEY
PQNIKNINFTTSDKVSVLIGSTAQEIGILPGAIFTGVYQWISLKEYLDKR
LLNFSLSYSKIFDLYKNINNINDSAQYAYETISSDVRINCPSNKLAKDIL
LSNKYDVFRYIVTNYPNKPVSLNGFPPSKYAVHFWDSTALFNFKAVNNYS
LSETDKLFAKTLQENIKHFMIYGHMLRSDWSEGKTGVFNTQGLLETLESD
YHSMICSFWNDPKNDFISYAWIN


References
    Title: Punctuated emergences of genetic and phenotypic innovations in eumetazoan, bilaterian, euteleostome, and hominidae ancestors
    Wenger Y, Galliot B
    Ref: Genome Biol Evol, 5:1949, 2013 : PubMed

            

    Title: Molecular characterization of Hydra acetylcholinesterase and its catalytic activity
    Takahashi T, Hamaue N
    Ref: FEBS Letters, 584:511, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer