Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: hypma-a0a151vyc0

Hypsizygus marmoreus (White beech mushroom) (Agaricus marmoreus). Carboxylic ester hydrolase

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Hypsizygus marmoreus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Lyophyllaceae: N E > Hypsizygus: N E > Hypsizygus marmoreus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : LUEZ01000012
Sequence
Graphical view for this peptide sequence: hypma-a0a151vyc0
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MAPLSLLTAALSLSLLASTSTPSPPLDIHLPTGTFRGISTPTGIQKWLGI
PYALPPTGVRRFKAPVPLLPVRSALVDASTFGNACPQPPSGDLGAPVEED
CLVLNVRTVLVWMWFGPKGTERKDALPVLVWIHGGAYTVGHHPKEHNERQ
TTHIRLHLASANVLPQDLNAGLLDQRQALIFVQENIAAFGGDPSKVTIWG
QSAGAGSVEAHFVFPSPQKLFRAGIADSSTGPFKNSPEASTYDEPGKPFA
RLLAATGCSAGRGSIACLRRVPFETLMNASNAMIQSTLNHQLWQPAVGPA
GSMVPERASARIMRGEFLHLPYLAGTNVNEGTTFSTTLRNLHLPSTSSED
TAFTTFINDLVIDNSTLTARMLAQTRKLWPANDPSLGAPFNTGDSLFDRG
AAWYTDNMFLAPRRLFFEKAAGRQRVFGYYFREFIPGNDLALGVAHASEL
QLLFGPISAAAQVETGFANTMLDFYINFVNDLNPGANWPAFTLASRRVMQ
LLRDNVTLIPDDWELEKTDFLNTVEVLDEFEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAPLSLLTAALSLSLLASTSTPSPPLDIHLPTGTFRGISTPTGIQKWLGI
PYALPPTGVRRFKAPVPLLPVRSALVDASTFGNACPQPPSGDLGAPVEED
CLVLNVRTVLVWMWFGPKGTERKDALPVLVWIHGGAYTVGHHPKEHNERQ
TTHIRLHLASANVLPQDLNAGLLDQRQALIFVQENIAAFGGDPSKVTIWG
QSAGAGSVEAHFVFPSPQKLFRAGIADSSTGPFKNSPEASTYDEPGKPFA
RLLAATGCSAGRGSIACLRRVPFETLMNASNAMIQSTLNHQLWQPAVGPA
GSMVPERASARIMRGEFLHLPYLAGTNVNEGTTFSTTLRNLHLPSTSSED
TAFTTFINDLVIDNSTLTARMLAQTRKLWPANDPSLGAPFNTGDSLFDRG
AAWYTDNMFLAPRRLFFEKAAGRQRVFGYYFREFIPGNDLALGVAHASEL
QLLFGPISAAAQVETGFANTMLDFYINFVNDLNPGANWPAFTLASRRVMQ
LLRDNVTLIPDDWELEKTDFLNTVEVLDEFEK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer