Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: icttr-k7gt76

Ictidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus). Pancreatic lipase

Comment
another sequence from adipose tissue was released with a signal peptide and one aa difference


Relationship
Family|Pancreatic_lipase
Block| L
Position in NCBI Life Tree|Ictidomys tridecemlineatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Sciuromorpha: N E > Sciuridae: N E > Xerinae: N E > Marmotini: N E > Ictidomys: N E > Ictidomys tridecemlineatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AGTP01018465, AF027293, AF177403
1 UniProt : K7GT76
2 Ncbi-nid : 5733828, 5762487
2 Ncbi-pid : 5733829, 5762488
2 UniProt : K7GT76, O88354
2 Interpro : K7GT76, O88354
2 Prodom : K7GT76, O88354
2 Pfam : K7GT76, O88354
2 PIRSF : K7GT76, O88354
2 SUPERFAM : K7GT76, O88354
Sequence
Graphical view for this peptide sequence: icttr-k7gt76
Colored MSA for Pancreatic_lipase (raw)
MLLVWSLALLLGAVAGKEVCYDRLGCFSDDSPWSGIVERPLKVLPWSPAD
VNTRFLLYTNENQDNYQQITADSSRIQSSNFKTNRKTRFIIHGFIDKGEE
SWLANMCKKMFQVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVD
FLRTQLGYSPSNVHVIGHSLGSHAAGEAGRRTNGAIGRITGLDPAEPCFE
GTPELVRLDPSDAQFVDAIHTDGAPIVPNLGFGMSQTVGHLDFFPNGGIE
MPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPTGFAAF
SCASYSVFSANKCFPCPSGGCPQMGHYADRYSGKTNGVGQKFYLNTGDKS
NFSRWRYKVSVTLSGQKVTGHILVSLFGNAGNSKQYEIYKGSLQPGYTHS
NEFDSDVDVGDLQRVKFIWYNNVINPSLPRVGASSISVERNDGRVFKFCS
AETVREDVLLTLNAC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLVWSLALLLGAVAGKEVCYDRLGCFSDDSPWSGIVERPLKVLPWSPAD
VNTRFLLYTNENQDNYQQITADSSRIQSSNFKTNRKTRFIIHGFIDKGEE
SWLANMCKKMFQVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVD
FLRTQLGYSPSNVHVIGHSLGSHAAGEAGRRTNGAIGRITGLDPAEPCFE
GTPELVRLDPSDAQFVDAIHTDGAPIVPNLGFGMSQTVGHLDFFPNGGIE
MPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPTGFAAF
SCASYSVFSANKCFPCPSGGCPQMGHYADRYSGKTNGVGQKFYLNTGDKS
NFSRWRYKVSVTLSGQKVTGHILVSLFGNAGNSKQYEIYKGSLQPGYTHS
NEFDSDVDVGDLQRVKFIWYNNVINPSLPRVGASSISVERNDGRVFKFCS
AETVREDVLLTLNAC


Reference
    Title: Low-temperature carbon utilization is regulated by novel gene activity in the heart of a hibernating mammal
    Andrews MT, Squire TL, Bowen CM, Rollins MB
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 95:8392, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer