Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: leiaq-u2r5k2

Leifsonia aquatica ATCC 14665, Uncharacterized protein

Relationship
Family|Duf_1023
Block| X
Position in NCBI Life Tree|Leifsonia aquatica ATCC 14665
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Microbacteriaceae: N E > Leifsonia: N E > Leifsonia aquatica: N E > Leifsonia aquatica ATCC 14665: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : WP_021763686.1
1 UniProt : U2R5K2
1 Interpro : U2R5K2
1 Pfam : U2R5K2
1 PIRSF : U2R5K2
1 SUPERFAM : U2R5K2
Sequence
Graphical view for this peptide sequence: leiaq-u2r5k2
Colored MSA for Duf_1023 (raw)
IEKDEKLLAELTAIRRAFGGGPEGAPPHQLYAYQPGEHTKVALSTGLIDD
AEHVSLIVPGMGTTAGDIWNYGNAARALREAQAVASGLDASKIAVIAWLD
YDPPGAIDVVGVIRNELAEAGADRLGRTLQGLQGIEGWGAQSSQLSVVAH
SYGTNVAAIALARPGVSAGNVVMLGSAGVSGGAPVAGVLNVPLGEVYATQ
AVADEWAPLGQFVSGRTDPTDPGYGAKVFTSEGTSINGRDLKGVSSHGPF
GSEKEPSYLNDFTSAQYAAAMASMGKGAELQYEGTPDDRSGLRTGNRVGG
LTR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

IEKDEKLLAELTAIRRAFGGGPEGAPPHQLYAYQPGEHTKVALSTGLIDD
AEHVSLIVPGMGTTAGDIWNYGNAARALREAQAVASGLDASKIAVIAWLD
YDPPGAIDVVGVIRNELAEAGADRLGRTLQGLQGIEGWGAQSSQLSVVAH
SYGTNVAAIALARPGVSAGNVVMLGSAGVSGGAPVAGVLNVPLGEVYATQ
AVADEWAPLGQFVSGRTDPTDPGYGAKVFTSEGTSINGRDLKGVSSHGPF
GSEKEPSYLNDFTSAQYAAAMASMGKGAELQYEGTPDDRSGLRTGNRVGG
LTR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer