Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lepde-ACHE

Leptinotarsa decemlineata colorado potato beetle (Doryphora decemlineata) acetylcholinesterase

Comment
The genbank and SWP sequences correspond to the mutated enzyme APWSYMSGERA and not the sensitive enzyme APWSYMSSERA (S291G) RSI corresponds to the wild type enzyme, RGI to S291G, KGI to R30K/S291G, RGT S291G/I392T C terminus H peptide


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Leptinotarsa decemlineata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Coleoptera: N E > Polyphaga: N E > Cucujiformia: N E > Chrysomeloidea: N E > Chrysomelidae: N E > Chrysomelinae: N E > Doryphorini: N E > Leptinotarsa: N E > Leptinotarsa decemlineata: N E


Molecular evidence
Database
5 mutations: Table (e.g. : I392T, R30K/S291G, R30K ... more)
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 45 more: L41180, L41180, GQ261991
>3 UniProt links 10 more: Q27677, D7NSF5, D7NSG0
1 Ncbi-nid : 758684
>3 UniProt links 18 more: Q27677, D7NSF5, D7NSG0
>3 Interpro links 18 more: Q27677, D7NSF5, D7NSG0
>3 Prodom links 18 more: Q27677, D7NSF5, D7NSG0
>3 Pfam links 18 more: Q27677, D7NSF5, D7NSG0
>3 PIRSF links 18 more: Q27677, D7NSF5, D7NSG0
>3 SUPERFAM links 18 more: Q27677, D7NSF5, D7NSG0
Sequence
Graphical view for this peptide sequence: lepde-ACHE
Colored MSA for ACHE (raw)
MGQLSILCLFVTVCASVCGYSWPSDETTTKPSQFKDFHTDPLVVETTSGL
VRGYSKTVLGREVHVFTGIPFAKPPIEQLRFKKPVPIDPWHGILDATKQP
NSCFQERYEYFPGFEGEEMWNPNTNISEDCLYLNIWVPQRLRIRHHADKP
TIDRPKVPVLIWIYGGGYMSGTATLDVYDADIIAATSDVIVASMQYRLGS
FGFLYLNRYFPRGSDETPGNMGLWDQILAIRWIKDNAAAFGGDPDLITLF
GESAGGGSISIHLISPVTKGLVRRGIMQSGTMNAPWSYMSSERAEQIGKI
LIQDCGCNVSLLENSPRKVMDCMRAVDAKTISLQQWNSYSGILGFPSTPT
IEGVLLPKHPMDMLAEGDYEDMEILLGSNHDEGTYFLLYDFIDFFEKDGP
SFLQREKYHDIIDTIFKNMSRLERDAIVFQYTNWEHVHDGYLNQKMIGDV
VGDYFFVCPTNNFAEVAADRGMKVFYYYFTHRTSTSLWGEWMGVIHGDEV
EYVFGHPLNMSLQFNSRERELSLKIMQAFARFATTGKPVTDDVNWPLYTK
DQPQYFIFNADKNGIGKGPRATACAFWNDFLPKLRDNSGSEEAPCVNTYL
SKIRSSSNELLPPSTSLVLIWIMTLLNAL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGQLSILCLFVTVCASVCGYSWPSDETTTKPSQFKDFHTDPLVVETTSGL
VRGYSKTVLGREVHVFTGIPFAKPPIEQLRFKKPVPIDPWHGILDATKQP
NSCFQERYEYFPGFEGEEMWNPNTNISEDCLYLNIWVPQRLRIRHHADKP
TIDRPKVPVLIWIYGGGYMSGTATLDVYDADIIAATSDVIVASMQYRLGS
FGFLYLNRYFPRGSDETPGNMGLWDQILAIRWIKDNAAAFGGDPDLITLF
GESAGGGSISIHLISPVTKGLVRRGIMQSGTMNAPWSYMSSERAEQIGKI
LIQDCGCNVSLLENSPRKVMDCMRAVDAKTISLQQWNSYSGILGFPSTPT
IEGVLLPKHPMDMLAEGDYEDMEILLGSNHDEGTYFLLYDFIDFFEKDGP
SFLQREKYHDIIDTIFKNMSRLERDAIVFQYTNWEHVHDGYLNQKMIGDV
VGDYFFVCPTNNFAEVAADRGMKVFYYYFTHRTSTSLWGEWMGVIHGDEV
EYVFGHPLNMSLQFNSRERELSLKIMQAFARFATTGKPVTDDVNWPLYTK
DQPQYFIFNADKNGIGKGPRATACAFWNDFLPKLRDNSGSEEAPCVNTYL
SKIRSSSNELLPPSTSLVLIWIMTLLNAL


References
11 more
    Title: Characterization of molecular and kinetic properties of two acetylcholinesterases from the Colorado potato beetle, Leptinotarsa decemlineata
    Yoon KA, Kim JH, Nauen R, Alyokhin A, Clark JM, Lee SH
    Ref: Pestic Biochem Physiol, 185:105137, 2022 : PubMed

            

    Title: Sequence variation and regulatory variation in acetylcholinesterase genes contribute to insecticide resistance in different populations of Leptinotarsa decemlineata
    Margus A, Piiroinen S, Lehmann P, Grapputo A, Gilbert L, Chen YH, Lindstrom L
    Ref: Ecol Evol, 11:15995, 2021 : PubMed

            

    Title: Molecular diagnostic for detecting the acetylcholinesterase mutations in insecticide-resistant populations of Colorado potato beetle, Leptinotarsa decemlineata (Say)
    Malek mohammadi M, Hejazi MJ, Mossadegh MS, Galehdari H, Khanjani M, Goodarzi MT
    Ref: , 104:150, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer