Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: locmi-ACHE1

Locusta migratoria manilensis (Oriental migratory locust) acetylcholinesterase-1 precursor

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Locusta migratoria manilensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Polyneoptera: N E > Orthoptera: N E > Caelifera: N E > Acrididea: N E > Acridomorpha: N E > Acridoidea: N E > Acrididae: N E > Oedipodinae: N E > Locusta: N E > Locusta migratoria: N E > Locusta migratoria manilensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : EU231603
1 UniProt : B6RIV6
1 Ncbi-nid : 165941748
1 Ncbi-pid : 165941749
1 UniProt : B6RIV6
1 Interpro : B6RIV6
1 Prodom : B6RIV6
1 Pfam : B6RIV6
1 PIRSF : B6RIV6
1 SUPERFAM : B6RIV6
Sequence
Graphical view for this peptide sequence: locmi-ACHE1
Colored MSA for ACHE (raw)
MCIFFTPPFEMAVVALGLNSRPARQVFGDFPGSVIWNPNTQLSEDCLYIN
VVAPKPRPRNAAAMVWIFGGGFYSGTATLDVYDHKTLVSEENVILVSMQY
RVASLGFLFFDTSDVPGNAGLFDQLMALQWVHDNIHYFGGNPHNVTLFGE
SAGAVSVSIHLLSPLSRNLFSQAIMQSGSPTAPWATIDREESILRGLRLA
EAVGCPHTKAEMPAVIDCLRRKNATELVNNEWGTLGICEFPFVPIIDGAI
LDETPQRSLAAKNFKKTNIMMGSNTEEGYYFIIYYLTELFRKEEDVYVSR
EEYLKAVRELNPYVNNVARQAIVFEYTDWANPDDPIGNRDALDKMVGDYH
FTCNVNELAHRYAETGNNVYMYYFKHRSAGNPWPSWTGVMHGDEINYVFG
EPLDPRKGYTPHEVELSRRMMRYWANFAKTGNPSKSEDGTWTATYWPVHT
AYGREYLTLAINSSETGRGPRLKQYAFWKKYLPQLIAMTTPQPAPEPPAC
VTNSTGAALQPAWGLGHRWRWGAAAQLPLAAAVALASLLRLDGTFV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCIFFTPPFEMAVVALGLNSRPARQVFGDFPGSVIWNPNTQLSEDCLYIN
VVAPKPRPRNAAAMVWIFGGGFYSGTATLDVYDHKTLVSEENVILVSMQY
RVASLGFLFFDTSDVPGNAGLFDQLMALQWVHDNIHYFGGNPHNVTLFGE
SAGAVSVSIHLLSPLSRNLFSQAIMQSGSPTAPWATIDREESILRGLRLA
EAVGCPHTKAEMPAVIDCLRRKNATELVNNEWGTLGICEFPFVPIIDGAI
LDETPQRSLAAKNFKKTNIMMGSNTEEGYYFIIYYLTELFRKEEDVYVSR
EEYLKAVRELNPYVNNVARQAIVFEYTDWANPDDPIGNRDALDKMVGDYH
FTCNVNELAHRYAETGNNVYMYYFKHRSAGNPWPSWTGVMHGDEINYVFG
EPLDPRKGYTPHEVELSRRMMRYWANFAKTGNPSKSEDGTWTATYWPVHT
AYGREYLTLAINSSETGRGPRLKQYAFWKKYLPQLIAMTTPQPAPEPPAC
VTNSTGAALQPAWGLGHRWRWGAAAQLPLAAAVALASLLRLDGTFV


References
    Title: Cloning of an acetylcholinesterase gene in Locusta migratoria manilensis related to organophosphate insecticide resistance
    Zhou X, Xia Y
    Ref: Pesticide Biochemistry and Physiology, 93:77, 2009 : PubMed

            

    Title: Increased activity and reduced sensitivity of acetylcholinesterase associated with malathion resistance in a field population of the oriental migratory locust, Locusta migratoria manilensis (Meyen)
    Yang M, Zhang J, Zhu KY, Xuan T, Liu X, Guo Y, Ma E
    Ref: Pesticide Biochemistry and Physiology, 91:32, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer