Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: macne-a0a2k6cpm2

Macaca nemestrina (Pig-tailed macaque). Lipase I

Relationship
Family|Phospholipase
Block| L
Position in NCBI Life Tree|Macaca nemestrina
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Cercopithecoidea: N E > Cercopithecidae: N E > Cercopithecinae: N E > Macaca: N E > Macaca nemestrina: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 UniProt : A0A2K6CPM2, A0A2K6CPI8
2 UniProt : A0A2K6CPM2, A0A2K6CPI8
2 Interpro : A0A2K6CPM2, A0A2K6CPI8
2 Prodom : A0A2K6CPM2, A0A2K6CPI8
2 Pfam : A0A2K6CPM2, A0A2K6CPI8
2 PIRSF : A0A2K6CPM2, A0A2K6CPI8
2 SUPERFAM : A0A2K6CPM2, A0A2K6CPI8
Sequence
Graphical view for this peptide sequence: macne-a0a2k6cpm2
Colored MSA for Phospholipase (raw)
MLLKCLHNNLCQKYSAHAFQLSPRNVLWLLVVCLRSNERPCLEFSHLSIK
DSFRDLFIPRIEIILMIYTRNNLNCAKPLFEHNNSLNVNFNTQKKTVWLI
HGYRPMGSIPSWLQNFVSILLNEEDMNVIVVDWNRGATTFIYDRAVKNTR
KVAVSLSGHIKNLLKHGASLDNFHFIGMSLGAHISGFVGKIFNGQLGRIT
GLDPAGPKFSRKPPYRRLDYTDAKFVDVIHSNSNGLGIREPLGHIDFYPN
GGRKQPGCPKSIFSGIKFIKCNHERAVHLFMASLETNCNFISFPCHSYKD
YKTSLCVDCDSFKEKSCPWLGYQAKLFKDVLKERIKGGPVRTTVFLDTSG
IYPFCTYYFILSITVPDKTVMDGFFSFKLLNQLGMIEEARFYKKNKPLCK
LQEIKILAQFYNDFANISSIGLTYFQSSNMECSTCTYKIQSLMLKSLTYP
ERPPLCRYNIVLKEREEVFLYPNACTPKKT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLKCLHNNLCQKYSAHAFQLSPRNVLWLLVVCLRSNERPCLEFSHLSIK
DSFRDLFIPRIEIILMIYTRNNLNCAKPLFEHNNSLNVNFNTQKKTVWLI
HGYRPMGSIPSWLQNFVSILLNEEDMNVIVVDWNRGATTFIYDRAVKNTR
KVAVSLSGHIKNLLKHGASLDNFHFIGMSLGAHISGFVGKIFNGQLGRIT
GLDPAGPKFSRKPPYRRLDYTDAKFVDVIHSNSNGLGIREPLGHIDFYPN
GGRKQPGCPKSIFSGIKFIKCNHERAVHLFMASLETNCNFISFPCHSYKD
YKTSLCVDCDSFKEKSCPWLGYQAKLFKDVLKERIKGGPVRTTVFLDTSG
IYPFCTYYFILSITVPDKTVMDGFFSFKLLNQLGMIEEARFYKKNKPLCK
LQEIKILAQFYNDFANISSIGLTYFQSSNMECSTCTYKIQSLMLKSLTYP
ERPPLCRYNIVLKEREEVFLYPNACTPKKT



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer