Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: macph-k2s0u2

Macrophomina phaseolina (strain MS6) (Charcoal rot fungus) Carboxylesterase type B

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Macrophomina phaseolina
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > dothideomyceta: N E > Dothideomycetes: N E > Dothideomycetes incertae sedis: N E > Botryosphaeriales: N E > Botryosphaeriaceae: N E > Macrophomina: N E > Macrophomina phaseolina: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AHHD01000521
1 UniProt : K2S0U2
1 UniProt : K2S0U2
1 Interpro : K2S0U2
1 Prodom : K2S0U2
1 Pfam : K2S0U2
1 PIRSF : K2S0U2
1 SUPERFAM : K2S0U2
Sequence
Graphical view for this peptide sequence: macph-k2s0u2
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MPDTIRVPYLKDLQFRGFIEGSTIKDKNSGKDLVHYFGGLPYGLPPIGPF
RWRMPRPLPPCYRYGTRANPGRFTGNTSMCPQGLPSWVKNAADNSHLWDE
DCLQCNIWVPAGTPPPGGWPVLFYIHGGFLQVGNPNEYNPVSLLSETPAR
FIIVMPAYRLNLLGFLASRELKAASSNEPVGNLGFWDQRLALEWTHKNIS
YFGGDARNITVAGYSAGSHSTFKQLAYDLYLPADKSVIRRAIMWSNGPGM
QPKSLLAAQDQFDELLTVLGIPLSLSGSEKVARLRAMPPGQLLAAVPKMQ
RHQFRAVVDNDFVRADLYKDIDSGAFAARMRARGVALLTGECRDEHCLYG
TWYPPAANTLEALRVRLRAEYPGDAVDALVAHYYPQGRLPDQCSDWRDAF
GRVYADMQVHHLERGFVDKLHAGGAGDLVFRYRVEWRLKCCDRFLPPDWG
VTHTADKPIWWWGNGMELTEDEKKVAWDALTGPYVRFVNGDLDGLRKEWG
TTGPRQVRRIDSQGKVSTWEDELWDEGTSVWNELRAVGATKTGRSIEESA
KL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPDTIRVPYLKDLQFRGFIEGSTIKDKNSGKDLVHYFGGLPYGLPPIGPF
RWRMPRPLPPCYRYGTRANPGRFTGNTSMCPQGLPSWVKNAADNSHLWDE
DCLQCNIWVPAGTPPPGGWPVLFYIHGGFLQVGNPNEYNPVSLLSETPAR
FIIVMPAYRLNLLGFLASRELKAASSNEPVGNLGFWDQRLALEWTHKNIS
YFGGDARNITVAGYSAGSHSTFKQLAYDLYLPADKSVIRRAIMWSNGPGM
QPKSLLAAQDQFDELLTVLGIPLSLSGSEKVARLRAMPPGQLLAAVPKMQ
RHQFRAVVDNDFVRADLYKDIDSGAFAARMRARGVALLTGECRDEHCLYG
TWYPPAANTLEALRVRLRAEYPGDAVDALVAHYYPQGRLPDQCSDWRDAF
GRVYADMQVHHLERGFVDKLHAGGAGDLVFRYRVEWRLKCCDRFLPPDWG
VTHTADKPIWWWGNGMELTEDEKKVAWDALTGPYVRFVNGDLDGLRKEWG
TTGPRQVRRIDSQGKVSTWEDELWDEGTSVWNELRAVGATKTGRSIEESA
KL


Reference
    Title: Tools to kill: genome of one of the most destructive plant pathogenic fungi Macrophomina phaseolina
    Islam MS, Haque MS, Islam MM, Emdad EM, Halim A, Hossen QM, Hossain MZ, Ahmed B, Rahim S and Alam M <5 more author(s)>
    Ref: BMC Genomics, 13:493, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer