Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: metcm-rdc1

Metacordyceps chlamydosporia (Pochonia chlamydosporia). Radicicol biosynthesis cluster protein rdc1; Thioesterase domain

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Metacordyceps chlamydosporia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : EU520419
1 UniProt : B3FWT6
1 UniProt : B3FWT6
1 Interpro : B3FWT6
1 Prodom : B3FWT6
1 Pfam : B3FWT6
1 PIRSF : B3FWT6
1 SUPERFAM : B3FWT6
Sequence
Graphical view for this peptide sequence: metcm-rdc1
Colored MSA for Thioesterase (raw)
DVLINTIVSETGLDPSELTDDTVVAELGVDSIMSIEIANKVSNATGEQLT
PMFLHEYPTIGDIKRAFDILTPVSSESDAELTEEYDLLEDTVTEEAVVHV
PSPSSTSLEAVVTGSITTKQRDAPQQPRSIGDGPEPAVRFTLLHGRASKR
VQDQQASPSPFYLIADGTGSIATYLHLPPHINTKMTIYGVDSPYLHCPSR
LTPDVGIPGIAKLIVDELVKRQPQGVPFWLGGFSGGAMIAYEIARQLSAL
GHVIDSLLLIDMCPPRQIQAQRYDDELGLAMFDAISGNDDSGVWESSDKT
HQHLKALFASVSAYNPPPLAKGESPPAKRVALIWAQKGMIDRCANSPRFR
QILADRGLVTESYPGFMEDPKLGPVAWSLIHKTESDLGPNGWDKFVGRDE
LLCMAVEADHLELPTPEFVHLLGEKMDMAFEHFGR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

DVLINTIVSETGLDPSELTDDTVVAELGVDSIMSIEIANKVSNATGEQLT
PMFLHEYPTIGDIKRAFDILTPVSSESDAELTEEYDLLEDTVTEEAVVHV
PSPSSTSLEAVVTGSITTKQRDAPQQPRSIGDGPEPAVRFTLLHGRASKR
VQDQQASPSPFYLIADGTGSIATYLHLPPHINTKMTIYGVDSPYLHCPSR
LTPDVGIPGIAKLIVDELVKRQPQGVPFWLGGFSGGAMIAYEIARQLSAL
GHVIDSLLLIDMCPPRQIQAQRYDDELGLAMFDAISGNDDSGVWESSDKT
HQHLKALFASVSAYNPPPLAKGESPPAKRVALIWAQKGMIDRCANSPRFR
QILADRGLVTESYPGFMEDPKLGPVAWSLIHKTESDLGPNGWDKFVGRDE
LLCMAVEADHLELPTPEFVHLLGEKMDMAFEHFGR


References
    Title: Hsp90 inhibition with resorcyclic acid lactones (RALs)
    Winssinger N, Fontaine JG, Barluenga S
    Ref: Curr Top Med Chem, 9:1419, 2009 : PubMed

            

    Title: Genes for the biosynthesis of the fungal polyketides hypothemycin from Hypomyces subiculosus and radicicol from Pochonia chlamydosporia
    Reeves CD, Hu Z, Reid R, Kealey JT
    Ref: Applied Environmental Microbiology, 74:5121, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer