morsp-deh1

 
Moraxella sp. B Comamonas acidovorans plasmid dehH1 gene for haloacetate dehalogenase H-1, complete cds

Comment
Comamonas acidovorans Q01398 D90422 for strain B Q7DI61 AB063332 AB049198 Comamonas acidovorans (Pseudomonas acidovorans) identical Sota et al


Relationship
Block X
Moraxella sp. position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Moraxella: N E > Moraxella sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : D90422, AB049198, AB063332
1 UniProt : Q01398
1 Ncbi-nid : 216772
1 Ncbi-pid : 216773
2 UniProtTrembl : Q01398, Q7DI61
2 Interpro : Q01398, Q7DI61
2 Prodom : Q01398, Q7DI61
2 Pfam : Q01398, Q7DI61
2 PIRSF : Q01398, Q7DI61
2 SUPERFAM : Q01398, Q7DI61
2 QuickSwissBlast : Q01398, Q7DI61
 
Sequence
Graphical view for this peptide sequence: morsp-deh1
Colored MSA for Haloacetate_dehalogenase (raw)
MDFPGFKNSTVTVDGVDIAYTVSGEGPPVLMLHGFPQNRAMWARVAPQLA
EHHTVVCADLRGYGDSDKPKCLPDRSNYSFRTFAHDQLCVMRHLGFERFH
LVGHDRGGRTGHRMALDHPEAVLSLTVMDIVPTYAMFMNTNRLVAASYWH
WYFLQQPEPFPEHMIGQDPDFFYETCLFGWGATKVSDFDQQMLNAYRESW
RNPAMIHGSCSDYRAAATIDLEHDSADIQRKVECPTLVFYGSKGQMGQLF
DIPAEWAKRCNNTTNASLPGGHFFVDQFPAETSEILLKFLARNG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDFPGFKNSTVTVDGVDIAYTVSGEGPPVLMLHGFPQNRAMWARVAPQLA
EHHTVVCADLRGYGDSDKPKCLPDRSNYSFRTFAHDQLCVMRHLGFERFH
LVGHDRGGRTGHRMALDHPEAVLSLTVMDIVPTYAMFMNTNRLVAASYWH
WYFLQQPEPFPEHMIGQDPDFFYETCLFGWGATKVSDFDQQMLNAYRESW
RNPAMIHGSCSDYRAAATIDLEHDSADIQRKVECPTLVFYGSKGQMGQLF
DIPAEWAKRCNNTTNASLPGGHFFVDQFPAETSEILLKFLARNG

Graphical view for this nucleotide DNA sequence (1579 bp): morsp-deh1
>morsp-deh1
gtcgacgattcactcaccgtgcctgccgtgtcggccgccttcaccggctt
ttccgacatgccgccggtgttcgccacggcttacatggtcggcttcgtcg
aatgggcgtgcattgaggcactccggccataccttgccccctcgcaacgc
acggtgggcacgcacgtcaatctgagccacagcgccgcgaccccggtggg
catgcaggttacggcagaggttgagctgatcgaggtcgaaggcaagcgct
tgacattcaaggtcttgtgccgcgacgaggtggacgtgatctgcgagggc
cggcacgagcgcttcatcgttgaagcgcagcagttcatcagacgagtcac
gtccaagggtgaacgtggctgagctttagggctaaagaagttgatcaacc
caggagacaaaaatggactttccaggattcaagaacagcaccgttaccgt
ggatggtgtggacatcgcctacaccgtaagcggcgaaggccctccggtgc
tgatgctgcatgggttcccgcagaaccgggccatgtgggcgcgcgtggct
ccccaactcgccgagcaccataccgtggtgtgtgccgacctgcgaggcta
tggcgattcggacaagcccaagtgcctgccggaccggtcaaactactcat
tccgcacgtttgcccatgaccaactctgtgtgatgcgccacctggggttc
gagcgcttccacctcgtcggacatgatcgcggcgggcgtaccggtcaccg
catggcgctggatcatcccgaagcggtgctgtcgctgaccgtcatggaca
tcgtgccgacgtatgcgatgttcatgaacaccaaccgtctggttgccgct
tcctactggcattggtatttcctgcagcagcctgagccgttccccgagca
catgatcggtcaggacccggacttcttctatgagacctgtttgttcgggt
ggggggcaaccaaggtgtcggactttgaccaacaaatgctgaacgcatat
cgggagtcttggcgcaacccagccatgattcacggctcatgctcggacta
ccgcgccgccgcaacaattgaccttgaacacgatagcgcggacatccaac
ggaaggtggaatgccccaccttggttttctacggctcaaaggggcagatg
gggcagctattcgacataccagccgagtgggcaaagcgctgcaacaacac
tacaaacgcatctctgccaggaggccatttcttcgtggatcagttccccg
cggaaacatcagagattcttttgaagtttcttgctcgaaacggctgatac
agcaggcgctgcttcgttcttgtgccagctaaaaataaacgctagagaga
gggcgaagcagtgttgaaacctgttcttgcgattgcctntgggtcggtac
ttggcggcctgctgcgatggggcttgggcctcaaattcaacaatctgctt
ccccatattccaccgggaacattaactgtcgcatcccgtacgatcatatg
gtcgcttgtgaaacaggtgcgggtgggtctggtacc



References
    Title: Structure of haloacetate-catabolic IncP-1beta plasmid pUO1 and genetic mobility of its residing haloacetate-catabolic transposon
    Sota M, Kawasaki H, Tsuda M
    Ref: Journal of Bacteriology, 185:6741, 2003 : PubMed

            

    Title: Characterization of a class II defective transposon carrying two haloacetate dehalogenase genes from Delftia acidovorans plasmid pUO1
    Sota M, Endo M, Nitta K, Kawasaki H, Tsuda M
    Ref: Applied Environmental Microbiology, 68:2307, 2002 : PubMed

            

    Title: Lack of homology between two haloacetate dehalogenase genes encoded on a plasmid from Moraxella sp. strain B
    Kawasaki H, Tsuda K, Matsushita I, Tonomura K
    Ref: J Gen Microbiol, 138:1317, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer