Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycht-t2gtw0

Mycobacterium avium subsp. hominissuis TH135, Uncharacterized protein

Comment
other strains: Mycobacterium avium (subsp. hominissuis TH135;10-5581)


Relationship
Family|Duf_1023
Block| X
Position in NCBI Life Tree|Mycobacterium avium subsp. hominissuis TH135
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium avium complex (MAC): N E > Mycobacterium avium: N E > Mycobacterium avium subsp. hominissuis: N E > Mycobacterium avium subsp. hominissuis TH135: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : V7JQW6
1 Interpro : V7JQW6
1 Prodom : V7JQW6
1 Pfam : V7JQW6
1 PIRSF : V7JQW6
1 SUPERFAM : V7JQW6
Sequence
Graphical view for this peptide sequence: mycht-t2gtw0
Colored MSA for Duf_1023 (raw)
EWRRQWDAANRARDGYADVKRSLGPPPSQVAPGGKVDPRNPPKYLGIIDD
KGHAAISINNPDTAKRDATFVPGTGQDTTRFSGSQDKSMRMYQAARDADA
RLQPGDVSVTTWMGYDRPMNLPQAASTSYAHNGAAALDDFQAGLRASHNN
AVTGGPSINTVIGHSYGSTEVGAASLGGHHLDANNVIAVGSPGMLTGHAS
DLNLDPGAHVYATRAQHDIISVATGWTLGPDPTGGDFGATTFEAAPGPSW
PFGLPSVAAHSSYWDSGNPALDNMGRIIAGRTDVTPPK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

EWRRQWDAANRARDGYADVKRSLGPPPSQVAPGGKVDPRNPPKYLGIIDD
KGHAAISINNPDTAKRDATFVPGTGQDTTRFSGSQDKSMRMYQAARDADA
RLQPGDVSVTTWMGYDRPMNLPQAASTSYAHNGAAALDDFQAGLRASHNN
AVTGGPSINTVIGHSYGSTEVGAASLGGHHLDANNVIAVGSPGMLTGHAS
DLNLDPGAHVYATRAQHDIISVATGWTLGPDPTGGDFGATTFEAAPGPSW
PFGLPSVAAHSSYWDSGNPALDNMGRIIAGRTDVTPPK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer