Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycia-h8ivh5

Mycobacterium intracellulare Mycobacterium sp. Mycobacterium yongonense; Mycobacterium chimaera, Uncharacterized protein

Comment
Other strains: Mycobacterium intracellulare (strains ATCC 13950 / DSM 43223 / JCM 638 / NCTC 13025 / 3600; MOTT-02; MOTT-64; MIN_052511_1280; MIN_061107_1834; 1956) Mycobacterium sp. (MOTT36Y; H4Y; TKK-01-0059) Mycobacterium indicus pranii MTCC 9506; Mycobacterium yongonense 05-1390; Mycobacterium avium subsp. avium 2285; Mycobacterium chimaera; Mycobacterium paraintracellulare


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Mycobacterium intracellulare
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium avium complex (MAC): N E > Mycobacterium intracellulare: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: mycia-h8ivh5
Colored MSA for Carb_B_Bacteria (raw)
MAIDDLVVETSNGPVRGVDDGRVKAWKGIRYAAAPVGDLRFRAPQPPERW
TEIADATVFGPACPQPVFPNMPLDLGAPQGEDCLRLNVWASSETRPGDAK
PVLVWLHGGAYVLGSSSQTLYDGSRLVSHGDVVVVTVNYRLGVLGFLDLT
SLDTAGRRFDSNVGLRDALAALEWVRDNVAAFGGDPHRVTLFGESAGAGI
VTTLLASPAADGLFAGAIAQSSPATSVYDRDRAHRVTQAFLGKLGIAPSE
AQRLVDMPMAAILAASQEVFDEVPARNPGTLAFVPIVDGDVLGDYPVKLA
QEGRTHPVPLIIGTNKHEAALFRLMRSPLMPITPSAITSMFNQIAAEQPD
LQLPTEEEIGSAYSRLRRKARSLSIATDVGFRMPSVWLAEGHAHAAPVYL
YRFDYSTPLLRLLTVGAAHATELPYVWGTLGAPKDPTLKLGGTRTAKAVS
KRVRTRWINFAAHGAPAGPTGEPEWPRYRATDRACLLIGKKDTLAHDVDA
NIRAAWGSEMVSFR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAIDDLVVETSNGPVRGVDDGRVKAWKGIRYAAAPVGDLRFRAPQPPERW
TEIADATVFGPACPQPVFPNMPLDLGAPQGEDCLRLNVWASSETRPGDAK
PVLVWLHGGAYVLGSSSQTLYDGSRLVSHGDVVVVTVNYRLGVLGFLDLT
SLDTAGRRFDSNVGLRDALAALEWVRDNVAAFGGDPHRVTLFGESAGAGI
VTTLLASPAADGLFAGAIAQSSPATSVYDRDRAHRVTQAFLGKLGIAPSE
AQRLVDMPMAAILAASQEVFDEVPARNPGTLAFVPIVDGDVLGDYPVKLA
QEGRTHPVPLIIGTNKHEAALFRLMRSPLMPITPSAITSMFNQIAAEQPD
LQLPTEEEIGSAYSRLRRKARSLSIATDVGFRMPSVWLAEGHAHAAPVYL
YRFDYSTPLLRLLTVGAAHATELPYVWGTLGAPKDPTLKLGGTRTAKAVS
KRVRTRWINFAAHGAPAGPTGEPEWPRYRATDRACLLIGKKDTLAHDVDA
NIRAAWGSEMVSFR


References
3 more
    Title: Complete genome sequence of Mycobacterium intracellulare strain ATCC 13950(T)
    Kim BJ, Choi BS, Lim JS, Choi IY, Lee JH, Chun J, Kook YH
    Ref: Journal of Bacteriology, 194:2750, 2012 : PubMed

            

    Title: Complete genome sequence of Mycobacterium intracellulare clinical strain MOTT-36Y, belonging to the INT5 genotype
    Kim BJ, Choi BS, Choi IY, Lee JH, Chun J, Hong SH, Kook YH
    Ref: Journal of Bacteriology, 194:4141, 2012 : PubMed

            

    Title: Molecular analysis of a leprosy immunotherapeutic bacillus provides insights into Mycobacterium evolution
    Ahmed N, Saini V, Raghuvanshi S, Khurana JP, Tyagi AK, Hasnain SE
    Ref: PLoS ONE, 2:e968, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer