Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycrh-g4i2j6

Mycobacterium rhodesiae JS60. Haloalkane dehalogenase

Relationship
Family|Haloalkane_dehalogenase-HLD1
Block| X
Position in NCBI Life Tree|Mycobacterium rhodesiae JS60
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium rhodesiae: N E > Mycobacterium rhodesiae JS60: N E


Molecular evidence
Database
No mutation
1 structure:
4MJ3: Haloalkane dehalogenases from Mycobacterium rhodesiae JS60
No kinetic





No Substrate
No inhibitor
1 Genbank : AGIQ01000003
1 UniProt : G4I2J6
1 Structure : 4MJ3
1 UniProt : G4I2J6
1 Interpro : G4I2J6
1 Prodom : G4I2J6
1 Pfam : G4I2J6
1 PIRSF : G4I2J6
1 SUPERFAM : G4I2J6
Sequence
Graphical view for this peptide sequence: mycrh-g4i2j6
Colored MSA for Haloalkane_dehalogenase-HLD1 (raw)
MDVLRTPDERFTALPDFPFAPRYVEVDSGDGGTLRMHYLDEGRSDGEVVL
LLHGEPSWSYLYRWMIPVLVEAGLRAVAIDLVGFGRSDKPTSRDDYTYQA
HVDWMWAAIEEIGLADVTLVCQDWGGLIGLRLVGEHPDRFARVVAANTML
PTGDHHPGEAFLAWQKFSQEVPLFPAGQIVNGGSLSTLSAETIAAYDAPF
PDASYQAGARQFPMLVPISPDDPATPANRKAWAALGRFEKPFLSAFSDSD
PITGAAEPVLRGHVPGARGQSHVTIAGAGHFLQEDKGRELAEAVVTFVRA
NPRAELNSSSVDKLAAALEH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDVLRTPDERFTALPDFPFAPRYVEVDSGDGGTLRMHYLDEGRSDGEVVL
LLHGEPSWSYLYRWMIPVLVEAGLRAVAIDLVGFGRSDKPTSRDDYTYQA
HVDWMWAAIEEIGLADVTLVCQDWGGLIGLRLVGEHPDRFARVVAANTML
PTGDHHPGEAFLAWQKFSQEVPLFPAGQIVNGGSLSTLSAETIAAYDAPF
PDASYQAGARQFPMLVPISPDDPATPANRKAWAALGRFEKPFLSAFSDSD
PITGAAEPVLRGHVPGARGQSHVTIAGAGHFLQEDKGRELAEAVVTFVRA
NPRAELNSSSVDKLAAALEH


Reference
    Title: Biochemical and biophysical characterisation of haloalkane dehalogenases DmrA and DmrB in Mycobacterium strain JS60 and their role in growth on haloalkanes
    Fung HK, Gadd MS, Drury TA, Cheung S, Guss JM, Coleman NV, Matthews JM
    Ref: Molecular Microbiology, 97:439, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer