Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: naefo-nf314

Naegleria fowleri virulence-related protein (NF314)

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Naegleria fowleri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Heterolobosea: N E > Schizopyrenida: N E > Vahlkampfiidae: N E > Naegleria: N E > Naegleria fowleri: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : M88397
1 UniProt : P42661
1 Ncbi-nid : 159719
1 Ncbi-pid : 159720
1 UniProt : P42661
1 Interpro : P42661
1 Pfam : P42661
1 PIRSF : P42661
1 SUPERFAM : P42661
Sequence
Graphical view for this peptide sequence: naefo-nf314
Colored MSA for Carboxypeptidase_S10 (raw)
MMMRCVNGQTAQDHLVTQLPGLSGNIGVKSYTGYLLANATRGRYLFYWFF
ESMRNPSQDPLVMWTNGGPGCSSLGGEASEHGLFLVNADGATITRNPYSW
NRVSNILYIEQPVGVGFSYSNSTDDYQNLNDVQAASDMNNALRDFLTRFP
QFIGRETYLAGESYGGVYVPTTAYNIVEGNGKGQQPYVNLVGILVGNGVT
DAEADSNSIPPMMKYHSLISIKYYEEGYKACQGDFYANQNLPACQKFLTD
SSNAMGNINPYYIYDSCPWLGINLQQKLKTTQEMTFQVLDPKTQQPVKIH
PLFQMYKHGGWSKRVANERNFAPRFETDAPCVPNQSIAKYFRRLDVQQAL
GVRRKTADPNGWNICTGIINYTQVYSTILPFYAKLLPHIRILVYSGDTDM
VVNGLGTQAAIDKLQLQETSSWRTWEFDSALGTVVGGYIRKFEKSGKGLT
FITVRGAGHMVPLVKPDSAFYMFKNFIDGTCC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMMRCVNGQTAQDHLVTQLPGLSGNIGVKSYTGYLLANATRGRYLFYWFF
ESMRNPSQDPLVMWTNGGPGCSSLGGEASEHGLFLVNADGATITRNPYSW
NRVSNILYIEQPVGVGFSYSNSTDDYQNLNDVQAASDMNNALRDFLTRFP
QFIGRETYLAGESYGGVYVPTTAYNIVEGNGKGQQPYVNLVGILVGNGVT
DAEADSNSIPPMMKYHSLISIKYYEEGYKACQGDFYANQNLPACQKFLTD
SSNAMGNINPYYIYDSCPWLGINLQQKLKTTQEMTFQVLDPKTQQPVKIH
PLFQMYKHGGWSKRVANERNFAPRFETDAPCVPNQSIAKYFRRLDVQQAL
GVRRKTADPNGWNICTGIINYTQVYSTILPFYAKLLPHIRILVYSGDTDM
VVNGLGTQAAIDKLQLQETSSWRTWEFDSALGTVVGGYIRKFEKSGKGLT
FITVRGAGHMVPLVKPDSAFYMFKNFIDGTCC


References
    Title: In Silico Structural Analysis of Serine Carboxypeptidase Nf314, a Potential Drug Target in Naegleria fowleri Infections
    Madero-Ayala PA, Mares-Alejandre RE, Ramos-Ibarra MA
    Ref: Int J Mol Sci, 23:12203, 2022 : PubMed

            

    Title: Cloning and characterization of transcripts showing virulence-related gene expression in Naegleria fowleri
    Hu W-N, Kopachik W, Band NR, Hu WN, Band RN
    Ref: Infect Immun, 60:2418, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer