Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: nomle-g1qvy9

Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein

Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Nomascus leucogenys
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hylobatidae: N E > Nomascus: N E > Nomascus leucogenys: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ADFV01013581, XP_004087355
2 UniProt : G1QVY9, A0A2I3HBM5
2 UniProt : G1QVY9, A0A2I3HBM5
2 Interpro : G1QVY9, A0A2I3HBM5
2 Prodom : G1QVY9, A0A2I3HBM5
2 Pfam : G1QVY9, A0A2I3HBM5
2 PIRSF : G1QVY9, A0A2I3HBM5
2 SUPERFAM : G1QVY9, A0A2I3HBM5
Sequence
Graphical view for this peptide sequence: nomle-g1qvy9
Colored MSA for Carb_B_Chordata (raw)
METAVRVESGVLVGVVCLLLACPATATGPKVAQPEVDTTLGRVRGRQVGV
KGTDRLVNVFLGIPFAQPPLGPDRFSAPRPAQPWEGVRDASTAPPMCLQD
VESMNNSRFVLNGKQQIFSVSEDCLVLNIYSPAEATAGAGRPVMVWVHGG
ALITGAATSYDGSALAAYGNVVVVTVQYRLGVLGFFSTGDEHAPGNQGFL
DVVAALRWVQGNITPFGGDLNCVTVFGGSAGGSIISGLVLSPMAAGLFHR
AITQSGVITTPGIIESHPWPLAQKITNTLACSSSSPAEMVQCLRQKEGEE
LVLSKKLKMTIYPLTVDGTVFPKSPKELLKEKPFYSVPFLMGVNNHEFSW
LIPRGWGLLDTMEQMSREDMLAISTPILTSLDVPPEMMPTIIDEYLGSNS
DAQAKRQAFQEFMGDVFINVPTYSFSRYLRDSGSPVFFYEFQHRPSSFAK
IKPAWVKADHAAEGAFVFGGPFLMDESSRLAFPEATEEEKQLSLTMMAQW
THFARTGDPNSKGLPPWPRFNQAEQYLEINPVPRARQKFREARMQFWSET
LPSKIQQWHQKQKNRKPQEDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

METAVRVESGVLVGVVCLLLACPATATGPKVAQPEVDTTLGRVRGRQVGV
KGTDRLVNVFLGIPFAQPPLGPDRFSAPRPAQPWEGVRDASTAPPMCLQD
VESMNNSRFVLNGKQQIFSVSEDCLVLNIYSPAEATAGAGRPVMVWVHGG
ALITGAATSYDGSALAAYGNVVVVTVQYRLGVLGFFSTGDEHAPGNQGFL
DVVAALRWVQGNITPFGGDLNCVTVFGGSAGGSIISGLVLSPMAAGLFHR
AITQSGVITTPGIIESHPWPLAQKITNTLACSSSSPAEMVQCLRQKEGEE
LVLSKKLKMTIYPLTVDGTVFPKSPKELLKEKPFYSVPFLMGVNNHEFSW
LIPRGWGLLDTMEQMSREDMLAISTPILTSLDVPPEMMPTIIDEYLGSNS
DAQAKRQAFQEFMGDVFINVPTYSFSRYLRDSGSPVFFYEFQHRPSSFAK
IKPAWVKADHAAEGAFVFGGPFLMDESSRLAFPEATEEEKQLSLTMMAQW
THFARTGDPNSKGLPPWPRFNQAEQYLEINPVPRARQKFREARMQFWSET
LPSKIQQWHQKQKNRKPQEDL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer