Gene_locus Report for: notfu-a0a1a8vaj7Nothobranchius furzeri (Turquoise killifish); Nothobranchius kuhntae (Beira killifish); Nothobranchius kadleci; Nothobranchius rachovii (bluefin notho); Nothobranchius pienaari; Nothobranchius korthausae. Serine hydrolase-like Comment Other strains: Nothobranchius furzeri (Turquoise killifish); Nothobranchius kuhntae (Beira killifish); Nothobranchius kadleci; Nothobranchius rachovii (bluefin notho); Nothobranchius pienaari; Nothobranchius korthausae Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Ovalentaria: N E > Atherinomorphae: N E > Cyprinodontiformes: N E > Aplocheiloidei: N E > Nothobranchiidae: N E > Nothobranchius: N E > Nothobranchius furzeri: N E
ABHD8 : notfu-a0a1a8aaf4Nothobranchius furzeri (Turquoise killifish); Nothobranchius kadleci; Nothobranchius kuhntae (Beira killifish). Abhydrolase domain containing 8. ABHD10 : notfu-a0a1a7zh85Nothobranchius furzeri (Turquoise killifish); N. kuhntae (Beira killifish); N. pienaari; N. rachovii (bluefin notho); N. kadlec; N korthausa. Abhydrolase domain containing 10b. ACHE : notfu-a0a1a7zwa9Nothobranchius furzeri ; N. kadleci; N. korthausae; N. kuhntae; N. pienaari; N. rachovii (Turquoise killifish, Beira killifish, bluefin notho), Carboxylic ester hydrolase. Arb2_FAM172A : notfu-a0a1a8b7e5Nothobranchius furzeri (Turquoise killifish); Nothobranchius kadleci; Nothobranchius rachovii (bluefin notho); Nothobranchius kuhntae (Beira killifish); Nothobranchius pienaari; Nothobranchius korthausae. Family with sequence similarity 172, member A. Arylacetamide_deacetylase : notfu-a0a1a8uxr5Nothobranchius furzeri (Turquoise killifish, Beira killifish) . Arylacetamide deacetylase-like 2. Cholinesterase-like : notfu-a0a1a8avy8Nothobranchius furzeri (Turquoise killifish); Nothobranchius kadleci, Carboxylic ester hydrolase. CMBL : notfu-a0a1a8awg6Nothobranchius furzeri (Turquoise killifish); Nothobranchius kadleci; Nothobranchius kuhntae (Beira killifish); Nothobranchius pienaari; Nothobranchius rachovii (bluefin notho); Nothobranchius korthausae. Carboxymethylenebutenolidase-like (Pseudomonas). Lipoprotein_Lipase : notfu-a0a1a8b2q9Nothobranchius furzeri (Turquoise killifish); Nothobranchius kuhntae (Beira killifish); Nothobranchius pienaari; Nothobranchius rachovii (bluefin notho); Nothobranchius korthausae; Nothobranchius kadleci. Lipase, endothelial. Monoglyceridelipase_lysophospholip : notfu-a0a1a7zvn5Nothobranchius furzeri (Turquoise killifish); Nothobranchius rachovii (bluefin notho); Nothobranchius kuhntae; kadleci; Nothobranchius pienaari . Monoglyceride lipase. Phospholipase : notfu-a0a1a8aba8Nothobranchius furzeri (Turquoise killifish); Nothobranchius kuhntae (Beira killifish); Nothobranchius kadleci; Nothobranchius pienaari; Nothobranchius rachovii (bluefin notho). Phospholipase A1 member A Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Nothobranchius kuhntae: N, E.
Nothobranchius kadleci: N, E.
Nothobranchius rachovii: N, E.
Nothobranchius pienaari: N, E.
Nothobranchius korthausae: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
>3 Genbank links 10 more: HADY01003316, HAEJ01016175, XP_015809916.1<13 Genbank links 10 less: HADY01003316, HAEJ01016175, XP_015809916.1, HAED01016957, HAEE01002506, HADZ01001223, HAEH01006896, HAEI01002817, HAEF01009059, HAEG01004883, HAEB01007623, HAEC01015778, HAEA01016720 |
Sequence Graphical view for this peptide sequence: notfu-a0a1a8vaj7
Colored MSA for SERHL (raw)
MIQALKGVRHVTSGTMKQAVSELLVPVPWGQIRGKVWGPDHGRPVLCLHG
WSDNCGSFNTLLPLLPTDFRYVAVDLPGHGFSSHRPPGIMYNFPSYVMDV
RRVVEALKWSKFSIIGHSMGGNIAGVFSAVFPEMVDAVVLLDSFGFLPTD
LKKIPVIIRQGFDEMIEFEKQPKEKTTRVYTYEKAVERLLAGNDSLTEQS
AKVLLERGLVQVEGGFVFSRDFRLNLKNVVRNTVEQCLDMQSKIQAPVLV
LLAEGGFEQKFLEPEQKKCFTVILQAYRNRNHTVVSVPGDHHVHLNNPEV
VAPLVSDFLQNKASSHSSRLKDAHTPKL
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MIQALKGVRHVTSGTMKQAVSELLVPVPWGQIRGKVWGPDHGRPVLCLHG
WSDNCGSFNTLLPLLPTDFRYVAVDLPGHGFSSHRPPGIMYNFPSYVMDV
RRVVEALKWSKFSIIGHSMGGNIAGVFSAVFPEMVDAVVLLDSFGFLPTD
LKKIPVIIRQGFDEMIEFEKQPKEKTTRVYTYEKAVERLLAGNDSLTEQS
AKVLLERGLVQVEGGFVFSRDFRLNLKNVVRNTVEQCLDMQSKIQAPVLV
LLAEGGFEQKFLEPEQKKCFTVILQAYRNRNHTVVSVPGDHHVHLNNPEV
VAPLVSDFLQNKASSHSSRLKDAHTPKL
|
|
|
|
