Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: paeam-PLAA

Paenibacillus amylolyticus pla depolymerase

Relationship
Family|Lipase_2
Block| X
Position in NCBI Life Tree|Paenibacillus amylolyticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Paenibacillaceae: N E > Paenibacillus: N E > Paenibacillus amylolyticus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: Polybutylene-succinate, Polylactic-acid
No inhibitor
1 Genbank : AB093482
1 UniProt : Q83VD0
1 Interpro : Q83VD0
1 Prodom : Q83VD0
1 Pfam : Q83VD0
1 PIRSF : Q83VD0
1 SUPERFAM : Q83VD0
Sequence
Graphical view for this peptide sequence: paeam-PLAA
Colored MSA for Lipase_2 (raw)
MRKLKLLLMVCMSMVFIFTLPGMGQSLKASAATERTPIVFVHGLTGSDSN
FALIERYLRGEGWSSDELFAIDLPSKAGNQLLNSAAISRFVDDVLRQTGH
SKVHIVAHSMGGANSLYYILNRGGIDKVDKLITLGGANRLTTSRAPDGIR
VTSIYSTSDTIVSPALSRLDGANNISVNLVTHIGLLYNSRVNALIKAALI
E
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRKLKLLLMVCMSMVFIFTLPGMGQSLKASAATERTPIVFVHGLTGSDSN
FALIERYLRGEGWSSDELFAIDLPSKAGNQLLNSAAISRFVDDVLRQTGH
SKVHIVAHSMGGANSLYYILNRGGIDKVDKLITLGGANRLTTSRAPDGIR
VTSIYSTSDTIVSPALSRLDGANNISVNLVTHIGLLYNSRVNALIKAALI
E


Reference
    Title: Cloning and sequencing of a poly(DL-lactic acid) depolymerase gene from Paenibacillus amylolyticus strain TB-13 and its functional expression in Escherichia coli
    Akutsu-Shigeno Y, Teeraphatpornchai T, Teamtisong K, Nomura N, Uchiyama H, Nakahara T, Nakajima-kambe T
    Ref: Applied Environmental Microbiology, 69:2498, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer