Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pench-q3hus2

Penicillium chrysogenum (Penicillium notatum) alpha-aminoadypil-cysteinyl-valine synthetase

Comment
only c-term PfamA Thioesterase 3561 3775


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Penicillium chrysogenum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Penicillium: N E > Penicillium chrysogenum species complex: N E > Penicillium chrysogenum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DQ192518
1 UniProt : Q3HUS2
1 UniProt : Q3HUS2
1 Interpro : Q3HUS2
1 Prodom : Q3HUS2
1 Pfam : Q3HUS2
1 PIRSF : Q3HUS2
1 SUPERFAM : Q3HUS2
Sequence
Graphical view for this peptide sequence: pench-q3hus2
Colored MSA for Thioesterase (raw)
GPTLFLLPPGEGGAESYFNNIVKRLRQTNMVVFNNYYLHSKRLRTFEELA
EMYLDQVRGIQPHGPYHFIGWSFGGILAMEMSRRLVASDEKIGFLGIIDT
YFNVRGATRTIGLGDTEILDPIHHIYNPDPANFQRLPSATDRIVLFKAMR
PNNKYESENQRRLYEYYDGTRLNGLDSLLPSDSDVQLVPLTDDTHFSWVG
NPQQVEQMCATIKEHLARY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GPTLFLLPPGEGGAESYFNNIVKRLRQTNMVVFNNYYLHSKRLRTFEELA
EMYLDQVRGIQPHGPYHFIGWSFGGILAMEMSRRLVASDEKIGFLGIIDT
YFNVRGATRTIGLGDTEILDPIHHIYNPDPANFQRLPSATDRIVLFKAMR
PNNKYESENQRRLYEYYDGTRLNGLDSLLPSDSDVQLVPLTDDTHFSWVG
NPQQVEQMCATIKEHLARY


Reference
    Title: Transcriptional and bioinformatic analysis of the 56.8 kb DNA region amplified in tandem repeats containing the penicillin gene cluster in Penicillium chrysogenum
    Fierro F, Garcia-Estrada C, Castillo NI, Rodriguez R, Velasco-Conde T, Martin JF
    Ref: Fungal Genet Biol, 43:618, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer