Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: penfn-faeb

Penicillium funiculosum (faeb) (cinnamoyl esterase)

Comment
Only n-term Pfam A Esterase_phd 34 250 not included Pfam A CBM_1 270 298 (CE1_SF2.2 in Li et al.2020)


Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Penicillium funiculosum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Trichocomaceae: N E > Talaromyces: N E > Talaromyces funiculosus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CAC14144, AJ291496
1 UniProt : Q9HE18
1 Ncbi-nid : 10945108
1 Ncbi-pid : 10945109
1 UniProt : Q9HE18
1 Interpro : Q9HE18
1 Pfam : Q9HE18
1 PIRSF : Q9HE18
1 SUPERFAM : Q9HE18
Sequence
Graphical view for this peptide sequence: penfn-faeb
Colored MSA for Esterase_phb (raw)
MAIPLVLVLAWLLPVVLAASLTQVNNFGDNPGSLQMYIYVPNKLASKPAI
IVAMHPCGGSATEYYGMYDYHSPADQYGYILIYPSATRDYNCFDAYSSAS
LTHNGGSDSLSIVNMVKYVISTYGADSSKVYMTGSSSGAIMTNVLAGAYP
DVFAAGSAFSGMPYACLYGAGAADPIMSNQTCSQGQIQHTGQQWAAYVHN
GYPGYTGQYPRLQMWHGTADNVISYADLGQEISQWTTIMGLSFTGNQTNT
PLSGYTKMVYGDGSKFQAYSAAGVGHFVPTDVSVVLDWFGITSGTTTTTT
PTTTPTTSTSPSSTGGCTAAH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAIPLVLVLAWLLPVVLAASLTQVNNFGDNPGSLQMYIYVPNKLASKPAI
IVAMHPCGGSATEYYGMYDYHSPADQYGYILIYPSATRDYNCFDAYSSAS
LTHNGGSDSLSIVNMVKYVISTYGADSSKVYMTGSSSGAIMTNVLAGAYP
DVFAAGSAFSGMPYACLYGAGAADPIMSNQTCSQGQIQHTGQQWAAYVHN
GYPGYTGQYPRLQMWHGTADNVISYADLGQEISQWTTIMGLSFTGNQTNT
PLSGYTKMVYGDGSKFQAYSAAGVGHFVPTDVSVVLDWFGITSGTTTTTT
PTTTPTTSTSPSSTGGCTAAH


Reference
    Title: A modular esterase from Penicillium funiculosum which releases ferulic acid from plant cell walls and binds crystalline cellulose contains a carbohydrate binding module
    Kroon PA, Williamson G, Fish NM, Archer DB, Belshaw NJ
    Ref: European Journal of Biochemistry, 267:6740, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer