Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: penfu-FAEA

Penicillium funiculosum ; Penicillium sp.; Talaromyces wortmannii ferulic acid esterase a precursor

Comment
contains a n-terminus 21-89 carbohydrate-binding module (CBM) Fungal cellulose binding domain most often associated with glycosyl hydrolases not related to alpha beta hydrolases . Other strains: Penicillium funiculosum; Penicillium sp.; Talaromyces wortmannii


Relationship
Family|FaeC
Block| X
Position in NCBI Life Tree|Penicillium funiculosum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Trichocomaceae: N E > Talaromyces: N E > Talaromyces funiculosus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: penfu-FAEA
Colored MSA for FaeC (raw)
STTTSTSASGTSLSSGCGKALSLKSGTYTTTVAGQQRQYTLTLPSNYNPN
KAYQLIFGYHWLGGTMGNVVSGSYYGIQPLAGDNAIFVAPQGLNNGWGNT
NGDDIIFTDQMLSTLENALCIDETQIYSMGWSYGGAMSYALACARPDVFR
AVAVMSGANLSGCSPGTQPVAYYGQHGVSDTVLPFSLGEGIRDTFVKDDH
CTPTNPPAPAAGSGTHIKTEYSGCDSEHPVWWIAFDGPHEPLATDAGASS
SWTPGQIWSFFSLFH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

STTTSTSASGTSLSSGCGKALSLKSGTYTTTVAGQQRQYTLTLPSNYNPN
KAYQLIFGYHWLGGTMGNVVSGSYYGIQPLAGDNAIFVAPQGLNNGWGNT
NGDDIIFTDQMLSTLENALCIDETQIYSMGWSYGGAMSYALACARPDVFR
AVAVMSGANLSGCSPGTQPVAYYGQHGVSDTVLPFSLGEGIRDTFVKDDH
CTPTNPPAPAAGSGTHIKTEYSGCDSEHPVWWIAFDGPHEPLATDAGASS
SWTPGQIWSFFSLFH



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer