Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pireq-faeb

Piromyces equi (esterase a) (esta) (cinnamoyl ester hydrolase) Feruloyl esterase B PeEstA U8

Comment
a long N-term sequence of repeats of MPWGDFGGNQGGG


Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Piromyces equi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Chytridiomycota: N E > Neocallimastigomycetes: N E > Neocallimastigales: N E > Neocallimastigaceae: N E > Piromyces: N E > Piromyces equi: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF164516
1 UniProt : Q9Y871
1 UniProt : Q9Y871
1 Interpro : Q9Y871
1 Pfam : Q9Y871
1 PIRSF : Q9Y871
1 SUPERFAM : Q9Y871
Sequence
Graphical view for this peptide sequence: pireq-faeb
Colored MSA for Esterase_phb (raw)
NSGPTVEYSTDVDCSGKTLKSNTNLNINGRKVIVKFPSGFTGDKAAPLLI
NYHPIMGSASQWESGSQTAKAALNDGAIVAFMDGAQGPMGQAWNVGPCCT
DADDVQFTRNFIKEITSKACVDPKRIYAAGFSMGGGMSNYAGCQLADVIA
AAAPSAFDLAKEIVDGGKCKPARPFPILNFRGTQDNVVMYNGGLSQVVQG
KPITFMGAKNNFKEWAKMNGCTGEPKQNTPGNNCEMYENCKGGVKVGLCT
INGGGHAEGDGKMGWDFVKQFSLP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

NSGPTVEYSTDVDCSGKTLKSNTNLNINGRKVIVKFPSGFTGDKAAPLLI
NYHPIMGSASQWESGSQTAKAALNDGAIVAFMDGAQGPMGQAWNVGPCCT
DADDVQFTRNFIKEITSKACVDPKRIYAAGFSMGGGMSNYAGCQLADVIA
AAAPSAFDLAKEIVDGGKCKPARPFPILNFRGTQDNVVMYNGGLSQVVQG
KPITFMGAKNNFKEWAKMNGCTGEPKQNTPGNNCEMYENCKGGVKVGLCT
INGGGHAEGDGKMGWDFVKQFSLP


Reference
    Title: A modular cinnamoyl ester hydrolase from the anaerobic fungus Piromyces equi acts synergistically with xylanase and is part of a multiprotein cellulose-binding cellulase-hemicellulase complex
    Fillingham IJ, Kroon PA, Williamson G, Gilbert HJ, Hazlewood GP
    Ref: Biochemical Journal, 343 Pt 1:215, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer