Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: proa4-k7rwz8

Propionibacterium acidipropionici (strain ATCC 4875 / DSM 20272 / JC 6432 / NBRC 12425 / NCIMB 8070) Carboxylesterase type B

Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Propionibacterium acidipropionici
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Propionibacteriaceae: N E > Acidipropionibacterium: N E > Acidipropionibacterium acidipropionici: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP003493
1 UniProt : K7RWZ8
1 UniProt : K7RWZ8
1 Interpro : K7RWZ8
1 Pfam : K7RWZ8
1 PIRSF : K7RWZ8
1 SUPERFAM : K7RWZ8
Sequence
Graphical view for this peptide sequence: proa4-k7rwz8
Colored MSA for Carb_B_Bacteria (raw)
MSRDEDLVVATEAGPVRGVVRDLEDGHRSIAFLGVPYAAAPVGELRFAAP
QPVSPWTGVRAAVEPGATPLRRQVDATLIPEPAVPGEETLNVNVFTPDIT
GFAPVMVWIHGGGFVSGSPNSPWYDGRAFNRDGVVTVSVSYRLGCEGYGV
LDAEPGAGPEVSNLGVLDQLAALQWVRRNIAAFGGDPRRVTIAGQSAGAT
AVLTLLAMPEAQPLFARALAISPTLVDAPLESARERTRAVAESAGVPATV
EGLRGVAPDRLLAAQDAIEQKAKGLKVLRGALAGRMWGPTIDGEVVERAT
LEALRAGVGASKPLMVGAARDEVGTMADELPEWTNRIPASWLMRSVVTDV
AARRGYLRENRRLVAEGGSVLLAKFVTDAVFRRVVPAVADARIGDDGGTW
VYGFGWRSPRSGWAHHCLDVPFWFDCLDDPAVIALAGQRPRQDLADAMHA
AAVSFIRGEEPAWPQWSEEARETRVFGANEIIDDQEGYYDGAMPLVAGLQ
AQR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSRDEDLVVATEAGPVRGVVRDLEDGHRSIAFLGVPYAAAPVGELRFAAP
QPVSPWTGVRAAVEPGATPLRRQVDATLIPEPAVPGEETLNVNVFTPDIT
GFAPVMVWIHGGGFVSGSPNSPWYDGRAFNRDGVVTVSVSYRLGCEGYGV
LDAEPGAGPEVSNLGVLDQLAALQWVRRNIAAFGGDPRRVTIAGQSAGAT
AVLTLLAMPEAQPLFARALAISPTLVDAPLESARERTRAVAESAGVPATV
EGLRGVAPDRLLAAQDAIEQKAKGLKVLRGALAGRMWGPTIDGEVVERAT
LEALRAGVGASKPLMVGAARDEVGTMADELPEWTNRIPASWLMRSVVTDV
AARRGYLRENRRLVAEGGSVLLAKFVTDAVFRRVVPAVADARIGDDGGTW
VYGFGWRSPRSGWAHHCLDVPFWFDCLDDPAVIALAGQRPRQDLADAMHA
AAVSFIRGEEPAWPQWSEEARETRVFGANEIIDDQEGYYDGAMPLVAGLQ
AQR


Reference
    Title: The genome sequence of Propionibacterium acidipropionici provides insights into its biotechnological and industrial potential
    Parizzi LP, Grassi MC, Llerena LA, Carazzolle MF, Queiroz VL, Lunardi I, Zeidler AF, Teixeira PJ, Mieczkowski P and Pereira GA <1 more author(s)>
    Ref: BMC Genomics, 13:562, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer