Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: proaa-e4afc9

Propionibacterium acnes (strains HL037PA3; HL037PA2; HL044PA1) Hydrolase, alpha/beta fold family protein

Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Propionibacterium acnes HL037PA3
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Propionibacteriaceae: N E > Cutibacterium: N E > [Propionibacterium] humerusii: N E > [Propionibacterium] humerusii HL037PA3: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : ADXV01000034, ADYH01000036, ADZU01000019
1 UniProt : E4HJV1
1 UniProt : E4HJV1
1 Interpro : E4HJV1
1 Prodom : E4HJV1
1 Pfam : E4HJV1
1 PIRSF : E4HJV1
1 SUPERFAM : E4HJV1
Sequence
Graphical view for this peptide sequence: proaa-e4afc9
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MIGGIVALQEIAFTSHNGRDHIQAWIYEPAADPVAVVQLVHGLGEHSRRY
LHMITTLLDARCIVVADDHAGHGRTAMLSGVWTDAGDDGAKVVVEDELTL
QGLVREQFPDLPYLVFGHSWGSMIARAMAVDPRARLNGLALCGVAAQLKG
LEHSLDREGLRAAVNADPAGRAEPVFVEQMFDGFLDRCGPNPGPTDWVAT
DPFIVRDHAKDKFNNFGAPMSNRFAWSFLEIYQRANSESFYRDLPPMPVL
IFSGGDDPVANFGDGAQQVADELSRAGHDVEIRIYPGLRHEVHNESESRA
DVEAKLVRFVTRVASAT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIGGIVALQEIAFTSHNGRDHIQAWIYEPAADPVAVVQLVHGLGEHSRRY
LHMITTLLDARCIVVADDHAGHGRTAMLSGVWTDAGDDGAKVVVEDELTL
QGLVREQFPDLPYLVFGHSWGSMIARAMAVDPRARLNGLALCGVAAQLKG
LEHSLDREGLRAAVNADPAGRAEPVFVEQMFDGFLDRCGPNPGPTDWVAT
DPFIVRDHAKDKFNNFGAPMSNRFAWSFLEIYQRANSESFYRDLPPMPVL
IFSGGDDPVANFGDGAQQVADELSRAGHDVEIRIYPGLRHEVHNESESRA
DVEAKLVRFVTRVASAT



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer