Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: proaa-e4afs9

Propionibacterium acnes; Propionibacterium humerusii; Hydrolase, alpha/beta domain protein

Comment
Other strains: Propionibacterium acnes (HL037PA3; HL037PA2; HL044PA1); Propionibacterium humerusii P08


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Propionibacterium acnes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Propionibacteriaceae: N E > Cutibacterium: N E > Cutibacterium acnes: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: ADXV01000037, ADYH01000035, ADZU01000017
2 UniProt : E4HJF2, F3P1U3
2 UniProt : E4HJF2, F3P1U3
2 Interpro : E4HJF2, F3P1U3
2 Prodom : E4HJF2, F3P1U3
2 Pfam : E4HJF2, F3P1U3
2 PIRSF : E4HJF2, F3P1U3
2 SUPERFAM : E4HJF2, F3P1U3
Sequence
Graphical view for this peptide sequence: proaa-e4afs9
Colored MSA for Proline_iminopeptidase (raw)
MTWNRNIPGLLTDDVRLRVPLDHSNPDDVRTIEVYARRVATLDGTDKPYL
IFLQGGPGCESPRPTLRDPGFPGWLSRALEDYQLVLLDQRGTGLSSPVSE
PVGDAASQAEYLTHLRADEIVEDCEDIRRHLGIQKWAALGQSFGGFTLLR
YLSTYSESLSAGYFTGGLSAVGRSADDIYAACYEQLRAKSLEYYKRFPGD
RERFAELAAFAKKGEITTPSGDVVCPSRLRSLGHLLGASGGAEKLHYLLE
YPHTSRAFRHDLVELLPYGGRNPLYTVIHESSYADGVVTDWSAARMLPED
FRKEPTLLTGEHVMPEWFDTDQELRPWKEVANLIANHPWPKLYDPDVLRS
VEVPCAAAVYHDDAYVPREFSLETASLLPQMHAWVTTEYEHNGSNASGGA
VLDRLIKLAKDEIVR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTWNRNIPGLLTDDVRLRVPLDHSNPDDVRTIEVYARRVATLDGTDKPYL
IFLQGGPGCESPRPTLRDPGFPGWLSRALEDYQLVLLDQRGTGLSSPVSE
PVGDAASQAEYLTHLRADEIVEDCEDIRRHLGIQKWAALGQSFGGFTLLR
YLSTYSESLSAGYFTGGLSAVGRSADDIYAACYEQLRAKSLEYYKRFPGD
RERFAELAAFAKKGEITTPSGDVVCPSRLRSLGHLLGASGGAEKLHYLLE
YPHTSRAFRHDLVELLPYGGRNPLYTVIHESSYADGVVTDWSAARMLPED
FRKEPTLLTGEHVMPEWFDTDQELRPWKEVANLIANHPWPKLYDPDVLRS
VEVPCAAAVYHDDAYVPREFSLETASLLPQMHAWVTTEYEHNGSNASGGA
VLDRLIKLAKDEIVR


Reference
    Title: Genome sequence of a novel species, Propionibacterium humerusii
    Butler-Wu SM, Sengupta DJ, Kittichotirat W, Matsen FA, 3rd, Bumgarner RE
    Ref: Journal of Bacteriology, 193:3678, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer