Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: proac-q6aa67

Cutibacterium acnes (strain DSM 16379 / KPA171202) (Propionibacterium acnes) Putative lysophospholipase

Comment
Other strains: Propionibacterium acnes (strains KPA171202 / DSM 16379; SK187; J165; SK137; J139; HL097PA1; HL030PA1; HL082PA2 HL110PA3 HL103PA1 HL110PA4 HL001PA1 HL060PA1 HL050PA2; HL086PA1; HL067PA1; HL063PA2; HL083PA2; HL036PA3; HL005PA4; HL005PA3; HL036PA1; HL096PA3; HL110PA2; HL007PA1; HL030PA2; HL082PA1; HL043PA1; HL053PA1; HL087PA2; HL038PA1; HL013PA1; HL027PA1; HL013PA2; HL043PA2; HL074PA1; HL053PA2; HL050PA3; HL078PA1; HL046PA1; HL056PA1; HL059PA1; HL002PA3; HL002PA2; HL072PA2; HL072PA1; HL046PA2; HL059PA2; HL025PA1; HL096PA2; HL110PA1; HL050PA1; HL087PA3; HL005PA1; HL045PA1; HL002PA1; HL005PA2; HL036PA2; HL083PA1; HL092PA1; HL027PA2; HL037PA1; HL063PA1)


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Propionibacterium acnes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Propionibacteriaceae: N E > Cutibacterium: N E > Cutibacterium acnes: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: proac-q6aa67
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MALQEIEFTSRNRRDAIQAWAYEPVGTPAAVVQIIHGLGEHSRRYLHMIS
ALLDASFIVVADDHAGHGRTAMQSGQWADAGDNSAEVVISDELTLQQQLT
GQFNDLPWVVFGHSWGSLIARAMATRPNARLDGLALGGVVAQLRGLETTL
DHEALAKAMATNPAGPAPESLVAQMFDGCTDRLSEGDGPTGWVARNRDVV
ADYGKDKFNNFGAQMSTRFLQGFADIYDMANGEGFYAAMPKIPIALFAGS
EDPAGNFGTGVQAVAQRLRRDGHDVELHLYDGLRHEVHNEPESRADVESS
LVTFVDRVAKRN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MALQEIEFTSRNRRDAIQAWAYEPVGTPAAVVQIIHGLGEHSRRYLHMIS
ALLDASFIVVADDHAGHGRTAMQSGQWADAGDNSAEVVISDELTLQQQLT
GQFNDLPWVVFGHSWGSLIARAMATRPNARLDGLALGGVVAQLRGLETTL
DHEALAKAMATNPAGPAPESLVAQMFDGCTDRLSEGDGPTGWVARNRDVV
ADYGKDKFNNFGAQMSTRFLQGFADIYDMANGEGFYAAMPKIPIALFAGS
EDPAGNFGTGVQAVAQRLRRDGHDVELHLYDGLRHEVHNEPESRADVESS
LVTFVDRVAKRN


Reference
    Title: The complete genome sequence of Propionibacterium acnes, a commensal of human skin
    Bruggemann H, Henne A, Hoster F, Liesegang H, Wiezer A, Strittmatter A, Hujer S, Durre P, Gottschalk G
    Ref: Science, 305:671, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer