Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseme-LIPA

Pseudomonas mendocina; Pseudomonas stutzeri; Pseudomonas xanthomarina; Pseudomonas sp.; Streptococcus pneumoniae; Pseudomonadales bacterium lipa (EC 3.1.1.3)

Comment
Other strains: Pseudomonas mendocina; Pseudomonas stutzeri (Pseudomonas perfectomarina) (DSM 4166 / CMT.9.A; A1501; B1SMN1; NF13); uncultured Pseudomonas sp.; Pseudomonas xanthomarina; Pseudomonas sp. (K35; BICA1-14); Streptococcus pneumoniae; Pseudomonadales bacterium RIFCSPHIGHO2_01_FULL_64_12 Pseudomonas stutzeri Lipase gene LK2 KP204884 LK3 KP204885 Transesterification Activity of Lipase Family I.1 97 and 95 % identical to the other sequences allowed molecular characterization of transesterification activity of lipase Family I.1


Relationship
Family|Bacterial_lip_FamI.1
Block| L
Position in NCBI Life Tree|Pseudomonas mendocina
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas aeruginosa group: N E > Pseudomonas mendocina: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 33 more: AY091666, CP000304, MHZJ01000060
>3 UniProt links 18 more: A4VL36, A0A1G3DKG4, S6K0N8
>3 UniProt links 20 more: Q8RKT7, A4VL36, A0A1G3DKG4
>3 Interpro links 20 more: Q8RKT7, A4VL36, A0A1G3DKG4
>3 Prodom links 20 more: Q8RKT7, A4VL36, A0A1G3DKG4
>3 Pfam links 20 more: Q8RKT7, A4VL36, A0A1G3DKG4
>3 PIRSF links 20 more: Q8RKT7, A4VL36, A0A1G3DKG4
>3 SUPERFAM links 20 more: Q8RKT7, A4VL36, A0A1G3DKG4
Sequence
Graphical view for this peptide sequence: pseme-LIPA
Colored MSA for Bacterial_lip_FamI.1 (raw)
MNKNKTLLALCLGSALALSGQAFAATGSGYTATKYPIVLTHGMLGFDSLL
GIDYWYGIPSALRRDGAQVYITEVSQLNTSELRGEELLAQVEEIVAISGK
PKVNLIGHSHGGPTIRYVAGVRPDLIASVTSVGAPHKGSDVADLIRKVPE
GSSGEAIIAGLVNAMGAFINFVSGSSSTAPQNSLGSLESLNSEGAARFNA
KFPQGIPTTACGEGAYKVNGVRYYSWSGTSPLTNPLDVSDAMMGAGSLAF
SGPNDGLVGRCSSHLGMVIRDDYRMNHLDEVNQFMGLTSLFETDPVSVYR
QHANRLKNAGL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNKNKTLLALCLGSALALSGQAFAATGSGYTATKYPIVLTHGMLGFDSLL
GIDYWYGIPSALRRDGAQVYITEVSQLNTSELRGEELLAQVEEIVAISGK
PKVNLIGHSHGGPTIRYVAGVRPDLIASVTSVGAPHKGSDVADLIRKVPE
GSSGEAIIAGLVNAMGAFINFVSGSSSTAPQNSLGSLESLNSEGAARFNA
KFPQGIPTTACGEGAYKVNGVRYYSWSGTSPLTNPLDVSDAMMGAGSLAF
SGPNDGLVGRCSSHLGMVIRDDYRMNHLDEVNQFMGLTSLFETDPVSVYR
QHANRLKNAGL


References
2 more
    Title: Purification and characterization of an alkaline lipase from a newly isolated Pseudomonas mendocina PK-12CS and chemoselective hydrolysis of fatty acid ester
    Jinwal UK, Roy U, Chowdhury AR, Bhaduri AP, Roy PK
    Ref: Bioorganic & Medicinal Chemistry, 11:1041, 2003 : PubMed

            

    Title: Characterization and physicochemical properties of a lipase from Pseudomonas mendocina 3121-1
    Surinenaite B, Bendikiene V, Juodka B, Bachmatova I, Marcinkevichiene L
    Ref: Biotechnol Appl Biochem, 36:47, 2002 : PubMed

            

    Title: Structure and function engineered Pseudomonas mendocina lipase
    Boston M, Requadt C, Danko S, Jarnagin A, Ashizawa E, Wu S, Poulose AJ, Bott R
    Ref: Methods Enzymol, 284:298, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer