Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psesg-q6tna2

Pseudomonas syringae (pv. glycinea) cmat

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Pseudomonas syringae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas syringae group: N E > Pseudomonas syringae group genomosp. 1: N E > Pseudomonas syringae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AY391839
1 UniProt : Q6TNA2
1 UniProt : Q6TNA2
1 Interpro : Q6TNA2
1 Pfam : Q6TNA2
1 PIRSF : Q6TNA2
1 SUPERFAM : Q6TNA2
Sequence
Graphical view for this peptide sequence: psesg-q6tna2
Colored MSA for Thioesterase (raw)
MADPFVVQRPWLAPLPGAPMNACRLLLCFPYGGGGASAFNGLSRLAEVGV
ATWAVKLPGREDRSMEAPVTRVAHVIEAILDALQSVGMPYAFYGHSFGAG
LALDVTHALVERDRPLPTNLVLSGRMPPHTGYSPLLGAMDDNQLWQHVCS
ESLLPLPTDASCSFARHALGKLKADLALNAQLTYRFIRPLPVPLYVLNGQ
DDPLLELHRLDEWQRYTSKSFHSEYVPGGHFFFNINFQLLYLPLLTALDE
QGS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADPFVVQRPWLAPLPGAPMNACRLLLCFPYGGGGASAFNGLSRLAEVGV
ATWAVKLPGREDRSMEAPVTRVAHVIEAILDALQSVGMPYAFYGHSFGAG
LALDVTHALVERDRPLPTNLVLSGRMPPHTGYSPLLGAMDDNQLWQHVCS
ESLLPLPTDASCSFARHALGKLKADLALNAQLTYRFIRPLPVPLYVLNGQ
DDPLLELHRLDEWQRYTSKSFHSEYVPGGHFFFNINFQLLYLPLLTALDE
QGS


Reference
    Title: Characterization of CmaA, an adenylation-thiolation didomain enzyme involved in the biosynthesis of coronatine
    Couch R, O'Connor SE, Seidle H, Walsh CT, Parry R
    Ref: Journal of Bacteriology, 186:35, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer