Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psyck-q1q7w8

Psychrobacter cryohalolentis (strain K5); Psychrobacter sp. G alpha/beta hydrolase fold-3 Lip1Pc

Comment
Other strains: Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5); Psychrobacter sp. (G; ANT_H56B; ANT_H59)


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Psychrobacter cryohalolentis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Psychrobacter: N E > Psychrobacter cryohalolentis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AAJC01000020, CP000323
2 UniProt : Q1Q7W8, D2XSH4
>3 UniProt links 1 more: Q1Q7W8, D2XSH4, A0A5B0AEA4
>3 Interpro links 1 more: Q1Q7W8, D2XSH4, A0A5B0AEA4
>3 Prodom links 1 more: Q1Q7W8, D2XSH4, A0A5B0AEA4
>3 Pfam links 1 more: Q1Q7W8, D2XSH4, A0A5B0AEA4
>3 PIRSF links 1 more: Q1Q7W8, D2XSH4, A0A5B0AEA4
>3 SUPERFAM links 1 more: Q1Q7W8, D2XSH4, A0A5B0AEA4
Sequence
Graphical view for this peptide sequence: psyck-q1q7w8
Colored MSA for Hormone-sensitive_lipase_like (raw)
MSNSTVLSVNTLLNKAVKTLNLMSFGQDKNPKSTDINISAEIMDIDESAL
QDSREDKGLSIKEKILEHHLMTNYQPHLLHYAIKSFGCLPTPILESLIKC
LDGPTSKQYLHVDAHLRLILAVNSKLKTPLQLIEMSELRKRFATDAVAMQ
APKVWQQASDNLLSNLKQFHKKGDSAISWQDRTIANADDGDMTIRCYQNE
TSDNGFGFKKEQTSNPDETVLLFFHGGGFCIGDLNTHHEFCHAICEQTGW
PVISVDYRLAPEHPAPAAVRDCISAYAWLAEHCEEFGALPSRIVLAGDSA
GGGLSTLMAQQIITPNKEAWLDLGDEGQKTFDILQGLPHPMAQMPLYPVT
DIETDYPSWELYGEGLLLDHADVAIFDAACLENSPLPRQHILTSPMLGDN
RQVCPSYVVAAELDVLRDEAFAYADQLKSYGIAVQTHTVLGAPHGFIHFM
SVHQRLGQETQHIITGFANFVREIIKTRALLSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNSTVLSVNTLLNKAVKTLNLMSFGQDKNPKSTDINISAEIMDIDESAL
QDSREDKGLSIKEKILEHHLMTNYQPHLLHYAIKSFGCLPTPILESLIKC
LDGPTSKQYLHVDAHLRLILAVNSKLKTPLQLIEMSELRKRFATDAVAMQ
APKVWQQASDNLLSNLKQFHKKGDSAISWQDRTIANADDGDMTIRCYQNE
TSDNGFGFKKEQTSNPDETVLLFFHGGGFCIGDLNTHHEFCHAICEQTGW
PVISVDYRLAPEHPAPAAVRDCISAYAWLAEHCEEFGALPSRIVLAGDSA
GGGLSTLMAQQIITPNKEAWLDLGDEGQKTFDILQGLPHPMAQMPLYPVT
DIETDYPSWELYGEGLLLDHADVAIFDAACLENSPLPRQHILTSPMLGDN
RQVCPSYVVAAELDVLRDEAFAYADQLKSYGIAVQTHTVLGAPHGFIHFM
SVHQRLGQETQHIITGFANFVREIIKTRALLSA


References
1 more
    Title: Complete Genome Sequence of Antarctic Bacterium Psychrobacter sp. Strain G
    Che S, Song L, Song W, Yang M, Liu G, Lin X
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Characterization of a cold-active lipase from Psychrobacter cryohalolentis K5(T) and its deletion mutants
    Novototskaya-Vlasova KA, Petrovskaya LE, Rivkina EM, Dolgikh DA, Kirpichnikov MP
    Ref: Biochemistry (Mosc), 78:385, 2013 : PubMed

            

    Title: Cloning and heterologous expression of two cold-active lipases from the Antarctic bacterium Psychrobacter sp. G.
    Lin X, Cui S, Xu G, Wang S, Du N
    Ref: Polar Research, 29:421, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer