Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rabit-BCHE

Oryctolagus cuniculus partial mRNA for butyrylcholinesterase

Comment
Cterminus T peptide


Relationship
Family|BCHE
Block| C
Position in NCBI Life Tree|Oryctolagus cuniculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Lagomorpha: N E > Leporidae: N E > Oryctolagus: N E > Oryctolagus cuniculus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: X52090, AAGW02014562, AAGW02014563
2 UniProt : P21927, G1SUE1
1 Ncbi-nid : 1476
2 UniProt : P21927, G1SUE1
2 Interpro : P21927, G1SUE1
2 Prodom : P21927, G1SUE1
2 Pfam : P21927, G1SUE1
2 PIRSF : P21927, G1SUE1
2 SUPERFAM : P21927, G1SUE1
Sequence
Graphical view for this peptide sequence: rabit-BCHE
Colored MSA for BCHE (raw)
MQDKDTIISIRFLFWFLLLCMVIRKSHTEDVIITTKNGRIRGINLPVLGG
TVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCYQNIDQSF
PGFHGSEMWNPNTDLSEDCLYLNVWIPTPKPKNATVMIWIYGGGFQTGTS
SLQVYDGKFLTRVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQL
ALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPRSHPLFTRAILQ
SGSSNAPWAVMSLHEARNRTLTLAKFVGCSTENETEIIKCLRNKDAQEIL
LNEVFVVPFDSLLSVNFGPTVDGDFLTDMPDTLLQLGQLKKTQILVGVNK
DEGTAFLVYGAPGFSKDNNSIITRKEFQDGLKIFFPRVSEFGKESILFHY
ADWLDDERPENYREALDDVVGDYNIICPALEFAKKCSEMGNNAYFYYFEH
RSSKLPWPEWMGVMHGYEIEFVFGLPLERRVNYTKAEEILSRSIMKRWAN
FAKYGNPNGTQNNSTRWPVFKSTEQKYLTLNTESPRIYTKLRAQQCRFWT
LFFPKVLEMTGNIDEAEQEWKAGFHRWNNYMMDWKNQFNDYTSKKESCAG
F
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQDKDTIISIRFLFWFLLLCMVIRKSHTEDVIITTKNGRIRGINLPVLGG
TVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCYQNIDQSF
PGFHGSEMWNPNTDLSEDCLYLNVWIPTPKPKNATVMIWIYGGGFQTGTS
SLQVYDGKFLTRVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQL
ALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPRSHPLFTRAILQ
SGSSNAPWAVMSLHEARNRTLTLAKFVGCSTENETEIIKCLRNKDAQEIL
LNEVFVVPFDSLLSVNFGPTVDGDFLTDMPDTLLQLGQLKKTQILVGVNK
DEGTAFLVYGAPGFSKDNNSIITRKEFQDGLKIFFPRVSEFGKESILFHY
ADWLDDERPENYREALDDVVGDYNIICPALEFAKKCSEMGNNAYFYYFEH
RSSKLPWPEWMGVMHGYEIEFVFGLPLERRVNYTKAEEILSRSIMKRWAN
FAKYGNPNGTQNNSTRWPVFKSTEQKYLTLNTESPRIYTKLRAQQCRFWT
LFFPKVLEMTGNIDEAEQEWKAGFHRWNNYMMDWKNQFNDYTSKKESCAG
F


References
    Title: Acetylcholinesterase and butyrylcholinesterase expression in adult rabbit tissues and during development
    Jbilo O, L'Hermite Y, Talesa V, Toutant JP, Chatonnet A
    Ref: European Journal of Biochemistry, 225:115, 1994 : PubMed

            

    Title: Complete sequence of rabbit butyrylcholinesterase
    Jbilo O, Chatonnet A
    Ref: Nucleic Acids Research, 18:3990, 1990 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer