Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhich-a3fm73

Rhizopus chinensis (Bread mold) Lipase r27RCL

Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Rhizopus chinensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Mucoromycota: N E > Mucoromycotina: N E > Mucorales: N E > Mucorineae: N E > Rhizopodaceae: N E > Rhizopus: N E > Rhizopus microsporus: N E > Rhizopus microsporus var. chinensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 4L3W, 6A0W
No kinetic





No Substrate
No inhibitor
1 Genbank : ABN59381
1 UniProt : A3FM73
2 Structure : 4L3W, 6A0W
1 UniProt : A3FM73
1 Interpro : A3FM73
1 Prodom : A3FM73
1 Pfam : A3FM73
1 PIRSF : A3FM73
1 SUPERFAM : A3FM73
Sequence
Graphical view for this peptide sequence: rhich-a3fm73
Colored MSA for Lipase_3 (raw)
MVSFISISQGVSLCLLVSSMMLGSSAVPVAGHKGSVKATNGTDFQLPPLI
SSRCTPPSHPETTGDPDAEAYYINKSVQWYQAHGGNYTALIKRDTETVGG
MTLDLPENPPPIPATSTAPSSDSGEVVTATAAQIKELTNYAGVAATAYCR
SVVPGTKWDCKQCLKYVPDGKLIKTFTSLLTDTNGFILRSDAQKTIYVTF
RGTNSFRSAITDMVFTFTDYSPVKGAKVHAGFLSSYNQVVKDYFPVVQDQ
LTAYPDYKVIVTGHSLGGAQALLAGMDLYQREKRLSPKNLSIYTVGCPRV
GNNAFAYYVDSTGIPFHRTVHKRDIVPHVPPQAFGYLHPGVESWIKEDPA
DVQICTSNIETKQCSNSIVPFTSIADHLTYFGINEGSCL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVSFISISQGVSLCLLVSSMMLGSSAVPVAGHKGSVKATNGTDFQLPPLI
SSRCTPPSHPETTGDPDAEAYYINKSVQWYQAHGGNYTALIKRDTETVGG
MTLDLPENPPPIPATSTAPSSDSGEVVTATAAQIKELTNYAGVAATAYCR
SVVPGTKWDCKQCLKYVPDGKLIKTFTSLLTDTNGFILRSDAQKTIYVTF
RGTNSFRSAITDMVFTFTDYSPVKGAKVHAGFLSSYNQVVKDYFPVVQDQ
LTAYPDYKVIVTGHSLGGAQALLAGMDLYQREKRLSPKNLSIYTVGCPRV
GNNAFAYYVDSTGIPFHRTVHKRDIVPHVPPQAFGYLHPGVESWIKEDPA
DVQICTSNIETKQCSNSIVPFTSIADHLTYFGINEGSCL


References
1 more
    Title: Structural Basis by Which the N-Terminal Polypeptide Segment of Rhizopus chinensis Lipase Regulates Its Substrate Binding Affinity
    Zhang M, Yu XW, Xu Y, Guo RT, Swapna GVT, Szyperski T, Hunt JF, Montelione GT
    Ref: Biochemistry, 58:3943, 2019 : PubMed

            

    Title: Backbone and Ile-delta1, Leu, Val methyl (1)H, (15)N, and (13)C, chemical shift assignments for Rhizopus chinensis lipase
    Zhang M, Yu XW, Swapna GVT, Liu G, Xiao R, Xu Y, Montelione GT
    Ref: Biomol NMR Assign, 12:63, 2018 : PubMed

            

    Title: Role of Met93 and Thr96 in the Lid Hinge Region of Rhizopus chinensis Lipase
    Zhu SS, Li M, Yu X, Xu Y
    Ref: Appl Biochem Biotechnol, 170:436, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer