(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Alphaproteobacteria: NE > Rhizobiales: NE > Rhizobiaceae: NE > Sinorhizobium/Ensifer group: NE > Sinorhizobium: NE > Sinorhizobium meliloti: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Sinorhizobium meliloti Rm41: N, E.
Sinorhizobium meliloti CCNWSX0020: N, E.
Rhizobium meliloti: N, E.
Sinorhizobium meliloti SM11: N, E.
Sinorhizobium meliloti 2011: N, E.
Sinorhizobium meliloti AK83: N, E.
Sinorhizobium meliloti BL225C: N, E.
Sinorhizobium meliloti GR4: N, E.
Sinorhizobium meliloti 1021: N, E.
Sinorhizobium meliloti RU11/001: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MAVIYSGDGGWRDIDKEVGNALQQQGVPVVGVDSLRYFWSERQPQATADD LARVITYYGRRWNVRNVLLIGYSFGADILPRTYNLLPSATRARVRQVTLM ALSHRADYKISVLGWLGADGEGNAGDPVDDIKAIEPALVQCIYGTDEEDD ACPDLKSSGIDVVSIEGGHHFDGDYAALTRRVLDALDRRLAMGR
Sinorhizobium meliloti is an alpha-proteobacterium that forms agronomically important N(2)-fixing root nodules in legumes. We report here the complete sequence of the largest constituent of its genome, a 62.7% GC-rich 3,654,135-bp circular chromosome. Annotation allowed assignment of a function to 59% of the 3,341 predicted protein-coding ORFs, the rest exhibiting partial, weak, or no similarity with any known sequence. Unexpectedly, the level of reiteration within this replicon is low, with only two genes duplicated with more than 90% nucleotide sequence identity, transposon elements accounting for 2.2% of the sequence, and a few hundred short repeated palindromic motifs (RIME1, RIME2, and C) widespread over the chromosome. Three regions with a significantly lower GC content are most likely of external origin. Detailed annotation revealed that this replicon contains all housekeeping genes except two essential genes that are located on pSymB. Amino acid/peptide transport and degradation and sugar metabolism appear as two major features of the S. meliloti chromosome. The presence in this replicon of a large number of nucleotide cyclases with a peculiar structure, as well as of genes homologous to virulence determinants of animal and plant pathogens, opens perspectives in the study of this bacterium both as a free-living soil microorganism and as a plant symbiont.
