Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhoca-bchO

Rhodobacter capsulatus (Rhodopseudomonas capsulata) bchO ORF284 , gene on complete photosynthesis gene cluster

Comment
Other strains: Rhodobacter capsulatus (Y262; ATCC BAA-309 / NBRC 16581 / SB1003) mentionned as magnesium-chelatase but not necessary Gilson et al. Proceedings of the National Academy of Sciences of the United States of America. 1995 Mar 14;92(6):1941-4 PMID: 7892204, But slightly homologous to chlorophyllases Tsuchiya et al. Proceedings of the National Academy of Sciences of the United States of America. 1999 96:15362-15367 PMID: 10611389


Relationship
Family|Mg-chelatase_BchO
Block| X
Position in NCBI Life Tree|Rhodobacter capsulatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhodobacterales: N E > Rhodobacteraceae: N E > Rhodobacter: N E > Rhodobacter capsulatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : Z11165, AYQB01000009, CP001312
2 UniProt : P26174, D5ANT6
1 Ncbi-nid : 46097
1 Ncbi-pid : 46119
2 UniProt : P26174, D5ANT6
2 Interpro : P26174, D5ANT6
2 Pfam : P26174, D5ANT6
2 PIRSF : P26174, D5ANT6
2 SUPERFAM : P26174, D5ANT6
Sequence
Graphical view for this peptide sequence: rhoca-bchO
Colored MSA for Mg-chelatase_BchO (raw)
MDPRALPANWPYRSAAARRRVGPIDWWVIDTGPADGPVLLLLHGLGASGH
SFRKMIPGLSARYRVIVPDLPGHGCSRSTARNRFGLKPMAEDLWKLCQHL
NVTPAAVIGHSAGGAIALQLALDTPVPRVVGINAALDHFEGVAGVVFPMM
ARGLAALPFTAPLVTRFGASRQRIGQLLDMTGSVIDAAGKAYYTALIQTP
EHVDGGLRMMAQWELGPLIGALPRIAKPVFLIAGNGDRAVPAHVSADAAR
FLPMATLRRIDGGHLIHEVAADGLSGMILDWLEG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDPRALPANWPYRSAAARRRVGPIDWWVIDTGPADGPVLLLLHGLGASGH
SFRKMIPGLSARYRVIVPDLPGHGCSRSTARNRFGLKPMAEDLWKLCQHL
NVTPAAVIGHSAGGAIALQLALDTPVPRVVGINAALDHFEGVAGVVFPMM
ARGLAALPFTAPLVTRFGASRQRIGQLLDMTGSVIDAAGKAYYTALIQTP
EHVDGGLRMMAQWELGPLIGALPRIAKPVFLIAGNGDRAVPAHVSADAAR
FLPMATLRRIDGGHLIHEVAADGLSGMILDWLEG


References
4 more
    Title: Analysis of the Rhodobacter capsulatus puf operon. Location of the oxygen-regulated promoter region and the identification of an additional puf-encoded gene
    Bauer CE, Young DA, Marrs BL
    Ref: Journal of Biological Chemistry, 263:4820, 1988 : PubMed

            

    Title: Nucleotide and deduced polypeptide sequences of the photosynthetic reaction-center, B870 antenna, and flanking polypeptides from R. capsulata
    Youvan DC, Bylina EJ, Alberti M, Begusch H, Hearst JE
    Ref: Cell, 37:949, 1984 : PubMed

            

    Title: Reaction center and light-harvesting I genes from Rhodopseudomonas capsulata
    Youvan DC, Alberti M, Begusch H, Bylina EJ, Hearst JE
    Ref: Proc Natl Acad Sci U S A, 81:189, 1984 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer