Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: salty-STM3079

Salmonella typhimurium, S. paratyphi, S. choleraesuis, S. agona, S. arizonae, S. dublin, S. enteritidis, S. gallinarum, S. heidelberg, S. newport, S. schwarzengrund, S. typhimurium, S. bongori, S. pullorum, S. enterica subsp. enterica, putative hydrolase or acyltransferase

Comment
There are more than 700 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Salmonella typhimurium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Salmonella: N E > Salmonella enterica: N E > Salmonella enterica subsp. enterica: N E > Salmonella enterica subsp. enterica serovar Typhimurium: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AE008841
1 UniProt : Q8ZM62
1 Interpro : Q8ZM62
1 Prodom : Q8ZM62
1 Pfam : Q8ZM62
1 PIRSF : Q8ZM62
1 SUPERFAM : Q8ZM62
Sequence
Graphical view for this peptide sequence: salty-STM3079
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MMLFLFNLNNMVFYTESDWRGVMNHIFKLAFIFIINIIFLINASATTMDK
DKFVEANGIKIHYVEEGEGPPLLLIHGGGLTAKSWQGLAKEASRYFRVIM
PDSRGHGLTNNPQGTFSYDLMTEDMAAFVKALKLEKPLVMGYSDGGMVVL
KLTSRYPDLARAAIVGGATHRFATTHYMQGMEIFYGKGMPQGQLTDRDLD
KMASDAPGMVKFYQNMHHPEQKDYWRTFLKGVWPMWTTPTSLAEEEVKKI
HIPVLLLDGDRDEFFTVEEVTELYRLLPQAEMTLIPGSGHAIFQTPGKTP
LFYALVLEFLQRQIPKAS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMLFLFNLNNMVFYTESDWRGVMNHIFKLAFIFIINIIFLINASATTMDK
DKFVEANGIKIHYVEEGEGPPLLLIHGGGLTAKSWQGLAKEASRYFRVIM
PDSRGHGLTNNPQGTFSYDLMTEDMAAFVKALKLEKPLVMGYSDGGMVVL
KLTSRYPDLARAAIVGGATHRFATTHYMQGMEIFYGKGMPQGQLTDRDLD
KMASDAPGMVKFYQNMHHPEQKDYWRTFLKGVWPMWTTPTSLAEEEVKKI
HIPVLLLDGDRDEFFTVEEVTELYRLLPQAEMTLIPGSGHAIFQTPGKTP
LFYALVLEFLQRQIPKAS


References
    Title: Genome-wide cloning and characterization of microbial esterases
    Ro HS, Hong HP, Kho BH, Kim S, Chung BH
    Ref: FEMS Microbiology Letters, 233:97, 2004 : PubMed

            

    Title: Complete genome sequence of Salmonella enterica serovar Typhimurium LT2
    McClelland M, Sanderson KE, Spieth J, Clifton SW, Latreille P, Courtney L, Porwollik S, Ali J, Dante M and Wilson RK <16 more author(s)>
    Ref: Nature, 413:852, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer