Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schco-d8q8g5

Schizophyllum commune H4-8 Putative uncharacterized protein

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Schizophyllum commune H4-8
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Schizophyllaceae: N E > Schizophyllum: N E > Schizophyllum commune: N E > Schizophyllum commune H4-8: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GL377308
1 UniProt : D8Q8G5
1 UniProt : D8Q8G5
1 Interpro : D8Q8G5
1 Pfam : D8Q8G5
1 PIRSF : D8Q8G5
1 SUPERFAM : D8Q8G5
Sequence
Graphical view for this peptide sequence: schco-d8q8g5
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MLFQYFSQVVFAAFALARPTVDLGYATYEGVCDGDSNTTHFLSVRYAAPP
TGDLRWRPPQPPLLQSGVQQATSQPPMCVQDPRGQATSAPPFARGEKTDK
NDTLLDACALQGICPLNDPTPPADSEDCLFLNVWTSGNFEAQTNTSKPVL
VWIHGGGYGSGGATGLAGVDVFDGKYPILRAQGDLVVVVIQYRLGMYGFL
AGSDVQAAGAANVGLLDQQFALQWVQEHIHKFGGNPSDVTIWGESAGGGS
VSEHVLANGGKTSPPLFTTAITSSDYLPPHYDIQDPIPEAIYDEVIKQAG
CKSEADALECLRKTDDAVLRRINADVAISAYSDVYIFMPVVDHTFVQQAP
TQAIAQGKVNGNHLLSVNNVDEGRIFINATRLGGDSFDAAEWLQNTWPRL
TDTEIAGALALYSELAPLEQAIKIDADVEFNCPTFSLMRAFDKPYKAEFA
IDNALHGYDLPYYFPDVGKLFPKSYNNTDFDTAFASAFTNFILAKDPNVK
VAADITPAWPSWSDEAPLEMVFNKTEDGVPDIQVKSVDSKLLERCSYWQS
IASSIGQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLFQYFSQVVFAAFALARPTVDLGYATYEGVCDGDSNTTHFLSVRYAAPP
TGDLRWRPPQPPLLQSGVQQATSQPPMCVQDPRGQATSAPPFARGEKTDK
NDTLLDACALQGICPLNDPTPPADSEDCLFLNVWTSGNFEAQTNTSKPVL
VWIHGGGYGSGGATGLAGVDVFDGKYPILRAQGDLVVVVIQYRLGMYGFL
AGSDVQAAGAANVGLLDQQFALQWVQEHIHKFGGNPSDVTIWGESAGGGS
VSEHVLANGGKTSPPLFTTAITSSDYLPPHYDIQDPIPEAIYDEVIKQAG
CKSEADALECLRKTDDAVLRRINADVAISAYSDVYIFMPVVDHTFVQQAP
TQAIAQGKVNGNHLLSVNNVDEGRIFINATRLGGDSFDAAEWLQNTWPRL
TDTEIAGALALYSELAPLEQAIKIDADVEFNCPTFSLMRAFDKPYKAEFA
IDNALHGYDLPYYFPDVGKLFPKSYNNTDFDTAFASAFTNFILAKDPNVK
VAADITPAWPSWSDEAPLEMVFNKTEDGVPDIQVKSVDSKLLERCSYWQS
IASSIGQ



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer