Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schga-ACHE

Schizaphis graminum acetylcholinesterase precursor mRNA

Comment
The cloned gene evolved from a different duplicate gene lineage of insect AChEs


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Schizaphis graminum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Sternorrhyncha: N E > Aphidomorpha: N E > Aphidoidea: N E > Aphididae: N E > Aphidinae: N E > Aphidini: N E > Schizaphis: N E > Schizaphis graminum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF321574
1 Ncbi-nid : 12958608
1 Ncbi-pid : 12958609
1 UniProt : Q9BMJ1
1 Interpro : Q9BMJ1
1 Prodom : Q9BMJ1
1 Pfam : Q9BMJ1
1 PIRSF : Q9BMJ1
1 SUPERFAM : Q9BMJ1
Sequence
Graphical view for this peptide sequence: schga-ACHE
Colored MSA for ACHE (raw)
MDQWLLWFGYLVASTYGLSLRHARHQSVGTPTAEEILEPQILIEDTDHVF
RQRASDMFAQEPEYTEKRNLNHRRRSEFSGNQDTDFASSGETYSAYTSDD
PLIIHTNKGKIRGITQTATTGKLVDAWLGIPYAKKPIGDLRFRHPRPIDR
WDTTTPETILNCTTPPNTCVQIFDTLFGDFPGATMWNPNSPVSEDCLYIN
VVVPKPRPQNAAVMVWIFGGGFYSGSATLDIYDPKILVSEENVILVSMQY
RVASLGFLYFDTEDVPGNAGLFDQLMALQWVHENIKLFGGNPNNVTLFGE
SAGAVSVSLHLLSPLSRNLFNQAIMESGSSTAPWAILSREESFNRGLKLA
KAMGCPDDRNTIHKTVECLRKANSSVMVEKEWDHVAICFFPFVPVVDGAF
LDDHPQKSLSTNNFKKTNILMGSNSEEGYYSIFYYLTELFKKEENVMVSR
ENFIKAIGQLNPNADAAVKSAIEFEYTDWFSPNDPEKNRNALDKMVGDYQ
FTCNVNEFAHKYALTGNNVYMYYFKHRSLNNPWPKWTGVMHGDEISYVFG
DPLNPNKRYEIEEIELSKKMMRYWTNFAKTGNPSKTLEGSWVTPKWPVHT
AYGKEFLTLDTNNTSIGVGPRLEQCAFWKNYVPDLTAISKSMKSDKNCTT
ISGGTKTNVIELSVWTIVMTTAVLML
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDQWLLWFGYLVASTYGLSLRHARHQSVGTPTAEEILEPQILIEDTDHVF
RQRASDMFAQEPEYTEKRNLNHRRRSEFSGNQDTDFASSGETYSAYTSDD
PLIIHTNKGKIRGITQTATTGKLVDAWLGIPYAKKPIGDLRFRHPRPIDR
WDTTTPETILNCTTPPNTCVQIFDTLFGDFPGATMWNPNSPVSEDCLYIN
VVVPKPRPQNAAVMVWIFGGGFYSGSATLDIYDPKILVSEENVILVSMQY
RVASLGFLYFDTEDVPGNAGLFDQLMALQWVHENIKLFGGNPNNVTLFGE
SAGAVSVSLHLLSPLSRNLFNQAIMESGSSTAPWAILSREESFNRGLKLA
KAMGCPDDRNTIHKTVECLRKANSSVMVEKEWDHVAICFFPFVPVVDGAF
LDDHPQKSLSTNNFKKTNILMGSNSEEGYYSIFYYLTELFKKEENVMVSR
ENFIKAIGQLNPNADAAVKSAIEFEYTDWFSPNDPEKNRNALDKMVGDYQ
FTCNVNEFAHKYALTGNNVYMYYFKHRSLNNPWPKWTGVMHGDEISYVFG
DPLNPNKRYEIEEIELSKKMMRYWTNFAKTGNPSKTLEGSWVTPKWPVHT
AYGKEFLTLDTNNTSIGVGPRLEQCAFWKNYVPDLTAISKSMKSDKNCTT
ISGGTKTNVIELSVWTIVMTTAVLML


Reference
    Title: Molecular cloning and characterization of a greenbug (Schizaphis graminum) cDNA encoding acetylcholinesterase possibly evolved from a duplicate gene lineage
    Gao JR, Kambhampati S, Zhu KY
    Ref: Insect Biochemistry & Molecular Biology, 32:765, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer