Gene_locus Report for: sheb5-a3d000Shewanella baltica Putative uncharacterized protein Comment Other strains: Shewanella baltica (OS155 / ATCC BAA-1091; OS223; OS195; OS678; OS183 BA175; OS185) Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Shewanellaceae: N E > Shewanella: N E > Shewanella baltica: N E
A85-EsteraseD-FGH : sheb2-b8e9b3Shewanella baltica (strains OS223; OS185; OS155 / ATCC BAA-1091; OS195) Shewanella sp. (strain W3-18-1) S-formylglutathione hydrolase. A85-IroE-IroD-Fes-Yiel : sheb8-a6whh0Shewanella baltica (strain OS185) Putative uncharacterized protein, sheb8-a6wli9Shewanella baltica (strains OS185; OS223; OS195) Putative esterase, sheb9-a9kyu5Shewanella baltica (strain OS195; OS185) Putative esterase. abh_upf0017 : sheb8-a6wjm0Shewanella baltica Alpha/beta hydrolase fold. abh_upf00227 : sheb2-y1944Shewanella baltica UPF0227 protein Sbal223_1944, sheb9-a9l1s9Shewanella baltica. Uncharacterized protein. BioH : sheb2-b8ecn6Shewanella baltica (strain OS223; OS155/ ATCC BAA-1091; OS195; OS185) Biotin synthesis protein BioH. DPP4N_Peptidase_S9 : sheb5-a3d2c4Shewanella baltica Peptidase S9, prolyl oligopeptidase active site domain protein, sheb8-a6wl16Shewanella baltica (strain OS185) Peptidase S9 prolyl oligopeptidase active site domain protein, sheb8-a6wsq5Shewanella baltica Peptidase S9B dipeptidylpeptidase IV domain protein, sheb8-a6wsu2Shewanella baltica Peptidase S9 prolyl oligopeptidase active site domain protein. Epoxide_hydrolase : sheb8-a6wnv5Shewanella baltica (strain OS185) (and strain OS155 / ATCC BAA-1091) Alpha/beta hydrolase fold. MenH_SHCHC : sheb8-a6wty5Shewanella baltica (strains OS185; OS155/ATCCBAA-1091; OS678; OS183; BA175; OS195; OS223; BA175; OS117; OS183) Alpha/beta hydrolase fold. Monoglyceridelipase_lysophospholip : sheb9-a9kwz5Shewanella baltica, Shewanella sp., Shewanella putrefaciens, Alpha/beta hydrolase fold. NLS3-Tex30 : sheb5-a3d2c0Shewanella baltica, Uncharacterized protein. Proline_iminopeptidase : sheb8-a6wi46Shewanella baltica (strains OS185; OS223; OS195; OS155 / ATCC BAA-1091; OS678; OS625) Alpha/beta hydrolase fold, sheb5-a3d659Shewanella baltica Prolyl aminopeptidase 2. Serine peptidase. MEROPS family S33, sheb5-a3dai0Shewanella baltica TAP domain protein Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Shewanella baltica OS155: N, E.
Shewanella baltica OS223: N, E.
Shewanella baltica OS195: N, E.
Shewanella baltica OS678: N, E.
Shewanella baltica OS183: N, E.
Shewanella baltica BA175: N, E.
Shewanella baltica OS185: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: sheb5-a3d000
Colored MSA for Duf_3530 (raw)
MARIISLLFCLLLGFIAISTRAADPATAAPTPAEVSTKKLNNRYLPENEV
KQITIDNQPYDLLVRPWEGKKKLGAAIILPATNGTADAPGLMAFVRRNIN
PAGWASLSLTPPTELPAANFATAATEVTSPGAAQLSSPSNKPSPKIKPED
NSKHLQEQEDFLVQSMSQLDAVGADYAGKRILITADQSAGLLISLLSQKK
IADPDVLIVINPYREDEKLNQALAEQLAKLTLPILDIQSPDGHPASLETA
ANRKILAVTLKSPNYRQTSLALNLDNESAWQNCLNAIKGFSARMSGAQ
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MARIISLLFCLLLGFIAISTRAADPATAAPTPAEVSTKKLNNRYLPENEV
KQITIDNQPYDLLVRPWEGKKKLGAAIILPATNGTADAPGLMAFVRRNIN
PAGWASLSLTPPTELPAANFATAATEVTSPGAAQLSSPSNKPSPKIKPED
NSKHLQEQEDFLVQSMSQLDAVGADYAGKRILITADQSAGLLISLLSQKK
IADPDVLIVINPYREDEKLNQALAEQLAKLTLPILDIQSPDGHPASLETA
ANRKILAVTLKSPNYRQTSLALNLDNESAWQNCLNAIKGFSARMSGAQ
|
|
|
|
